KEGG   Manis javanica (Malayan pangolin): 108392867
Entry
108392867         CDS       T06054                                 

Gene name
FAS
Definition
(RefSeq) tumor necrosis factor receptor superfamily member 6 isoform X1
  KO
K04390  tumor necrosis factor receptor superfamily member 6
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01524  Platinum drug resistance
mjv04010  MAPK signaling pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04115  p53 signaling pathway
mjv04210  Apoptosis
mjv04217  Necroptosis
mjv04650  Natural killer cell mediated cytotoxicity
mjv04668  TNF signaling pathway
mjv04932  Non-alcoholic fatty liver disease
mjv04940  Type I diabetes mellitus
mjv05010  Alzheimer disease
mjv05022  Pathways of neurodegeneration - multiple diseases
mjv05142  Chagas disease
mjv05143  African trypanosomiasis
mjv05160  Hepatitis C
mjv05161  Hepatitis B
mjv05162  Measles
mjv05163  Human cytomegalovirus infection
mjv05164  Influenza A
mjv05165  Human papillomavirus infection
mjv05167  Kaposi sarcoma-associated herpesvirus infection
mjv05168  Herpes simplex virus 1 infection
mjv05169  Epstein-Barr virus infection
mjv05170  Human immunodeficiency virus 1 infection
mjv05200  Pathways in cancer
mjv05205  Proteoglycans in cancer
mjv05320  Autoimmune thyroid disease
mjv05330  Allograft rejection
mjv05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108392867 (FAS)
   04668 TNF signaling pathway
    108392867 (FAS)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108392867 (FAS)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108392867 (FAS)
   04217 Necroptosis
    108392867 (FAS)
   04115 p53 signaling pathway
    108392867 (FAS)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    108392867 (FAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108392867 (FAS)
   05205 Proteoglycans in cancer
    108392867 (FAS)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    108392867 (FAS)
   05330 Allograft rejection
    108392867 (FAS)
   05332 Graft-versus-host disease
    108392867 (FAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108392867 (FAS)
   05022 Pathways of neurodegeneration - multiple diseases
    108392867 (FAS)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    108392867 (FAS)
   04932 Non-alcoholic fatty liver disease
    108392867 (FAS)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108392867 (FAS)
   05161 Hepatitis B
    108392867 (FAS)
   05160 Hepatitis C
    108392867 (FAS)
   05164 Influenza A
    108392867 (FAS)
   05162 Measles
    108392867 (FAS)
   05168 Herpes simplex virus 1 infection
    108392867 (FAS)
   05163 Human cytomegalovirus infection
    108392867 (FAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108392867 (FAS)
   05169 Epstein-Barr virus infection
    108392867 (FAS)
   05165 Human papillomavirus infection
    108392867 (FAS)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    108392867 (FAS)
   05143 African trypanosomiasis
    108392867 (FAS)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108392867 (FAS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mjv04050]
    108392867 (FAS)
   04090 CD molecules [BR:mjv04090]
    108392867 (FAS)
Cytokine receptors [BR:mjv04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   108392867 (FAS)
CD molecules [BR:mjv04090]
 Proteins
  108392867 (FAS)
SSDB
Motif
Pfam: Death TNFR_c6
Other DBs
NCBI-GeneID: 108392867
NCBI-ProteinID: XP_017508850
LinkDB
Position
Unknown
AA seq 254 aa
MPCPEGEEYTDKAHYSSKCRRCRICDGEHGLEVEKNCTRTQNTKCRCKSNFFCNISLCEH
CNPCIKCEHGVIENCTPTSNTRCKEVFQSADSRSHLWWLLLLILIPTAIVIFGVKKRCHK
NKQDGGCESGTLITEKVPMNLTDIDLNKYISSIAEHMKITQVKEFVRKNGVNEAKIDEIK
NDNPHDTAEQKIQLLRNWYQLHGKKDAYRTLIRSLKKANLCTLAEKIEDIVQKDIAREHE
NANFKSENERQSLT
NT seq 765 nt   +upstreamnt  +downstreamnt
atgccttgcccagaaggggaggaatacacagacaaggcacattattcttctaaatgcaga
aggtgtagaatttgtgatggagaacatggcttagaagtggaaaaaaactgtacccggacc
cagaataccaagtgcagatgtaaatcaaactttttctgtaacatttctctatgtgaacac
tgtaacccttgcatcaagtgtgaacatggagtcattgagaactgcaccccaaccagcaac
accagatgtaaagaagtgttccagtctgcagactccagatcgcacctgtggtggttgctc
ctcctgatcctgattccaacagctatagtaatatttggggtgaagaaaaggtgtcacaag
aataaacaggatggtggctgtgaatccgggaccttgattactgaaaaggtgccaatgaat
cttacagacattgacttgaataagtatatcagtagtattgctgaacacatgaaaataact
caagttaaagaattcgttcggaagaatggtgtcaatgaagccaaaatagatgagatcaag
aatgacaatcctcacgacacagctgaacagaaaatccagttgctccgtaactggtatcaa
cttcacgggaagaaagatgcatatcggactttgattagaagtctcaaaaaagccaatctt
tgcactcttgcagagaagattgaagatatagttcaaaaggacattgctagggagcatgaa
aatgcaaacttcaaaagtgaaaatgagaggcaaagcttgacctaa

DBGET integrated database retrieval system