KEGG   Manis javanica (Malayan pangolin): 108393091
Entry
108393091         CDS       T06054                                 

Gene name
BCL2L1
Definition
(RefSeq) bcl-2-like protein 1
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01521  EGFR tyrosine kinase inhibitor resistance
mjv01524  Platinum drug resistance
mjv04014  Ras signaling pathway
mjv04064  NF-kappa B signaling pathway
mjv04115  p53 signaling pathway
mjv04137  Mitophagy - animal
mjv04140  Autophagy - animal
mjv04151  PI3K-Akt signaling pathway
mjv04210  Apoptosis
mjv04215  Apoptosis - multiple species
mjv04621  NOD-like receptor signaling pathway
mjv04630  JAK-STAT signaling pathway
mjv05012  Parkinson disease
mjv05014  Amyotrophic lateral sclerosis
mjv05022  Pathways of neurodegeneration - multiple diseases
mjv05145  Toxoplasmosis
mjv05162  Measles
mjv05166  Human T-cell leukemia virus 1 infection
mjv05168  Herpes simplex virus 1 infection
mjv05170  Human immunodeficiency virus 1 infection
mjv05200  Pathways in cancer
mjv05202  Transcriptional misregulation in cancer
mjv05212  Pancreatic cancer
mjv05220  Chronic myeloid leukemia
mjv05222  Small cell lung cancer
mjv05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    108393091 (BCL2L1)
   04630 JAK-STAT signaling pathway
    108393091 (BCL2L1)
   04064 NF-kappa B signaling pathway
    108393091 (BCL2L1)
   04151 PI3K-Akt signaling pathway
    108393091 (BCL2L1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108393091 (BCL2L1)
   04137 Mitophagy - animal
    108393091 (BCL2L1)
  09143 Cell growth and death
   04210 Apoptosis
    108393091 (BCL2L1)
   04215 Apoptosis - multiple species
    108393091 (BCL2L1)
   04115 p53 signaling pathway
    108393091 (BCL2L1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    108393091 (BCL2L1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108393091 (BCL2L1)
   05202 Transcriptional misregulation in cancer
    108393091 (BCL2L1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    108393091 (BCL2L1)
   05225 Hepatocellular carcinoma
    108393091 (BCL2L1)
   05220 Chronic myeloid leukemia
    108393091 (BCL2L1)
   05222 Small cell lung cancer
    108393091 (BCL2L1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    108393091 (BCL2L1)
   05014 Amyotrophic lateral sclerosis
    108393091 (BCL2L1)
   05022 Pathways of neurodegeneration - multiple diseases
    108393091 (BCL2L1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108393091 (BCL2L1)
   05170 Human immunodeficiency virus 1 infection
    108393091 (BCL2L1)
   05162 Measles
    108393091 (BCL2L1)
   05168 Herpes simplex virus 1 infection
    108393091 (BCL2L1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108393091 (BCL2L1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108393091 (BCL2L1)
   01524 Platinum drug resistance
    108393091 (BCL2L1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mjv01009]
    108393091 (BCL2L1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mjv03036]
    108393091 (BCL2L1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mjv02000]
    108393091 (BCL2L1)
Protein phosphatases and associated proteins [BR:mjv01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     108393091 (BCL2L1)
Chromosome and associated proteins [BR:mjv03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    108393091 (BCL2L1)
Transporters [BR:mjv02000]
 Other transporters
  Pores ion channels [TC:1]
   108393091 (BCL2L1)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 108393091
NCBI-ProteinID: XP_017509189
LinkDB
Position
Unknown
AA seq 228 aa
MSQSNRELVVDFLSYKLSQKGYRWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMEVLVNRIATWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGS
NT seq 684 nt   +upstreamnt  +downstreamnt
atgtctcaaagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa
ggatacagatggagtcagtttagtgatgtggaagagaacagaactgaggccccagaaggg
actgaatcagagatggagacccccagtgccatcaatggcaacccatcctggcacctggca
gacagccccgcggtgaatggagccactggccacagcagcagcttggatgcccgggaggtg
atccccatggcagcggtgaagcaagcgctgagggaggcaggcgatgagtttgaactgagg
taccggcgggcattcagcgacctgacatcccagctccacattaccccagggacagcgtat
cagagctttgagcaggtagtgaatgaactcttccgggatggggtgaactggggtcgcatt
gtggcctttttctccttcggtggggcactgtgcgtggaaagcgtagacaaggagatggag
gtattggtgaatcggatcgcaacttggatggccacttacctgaatgaccacctagagcct
tggatccaggagaatggcggctgggacacttttgtggaactctacgggaacaatgcagca
gcggagagccggaagggccaggagcgcttcaaccgctggttcctgacgggcatgactgtg
gctggtgtggttctgctgggctca

DBGET integrated database retrieval system