KEGG   Manis javanica (Malayan pangolin): 108393483
Entry
108393483         CDS       T06054                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01524  Platinum drug resistance
mjv04115  p53 signaling pathway
mjv04210  Apoptosis
mjv04215  Apoptosis - multiple species
mjv04932  Non-alcoholic fatty liver disease
mjv05010  Alzheimer disease
mjv05012  Parkinson disease
mjv05014  Amyotrophic lateral sclerosis
mjv05016  Huntington disease
mjv05017  Spinocerebellar ataxia
mjv05020  Prion disease
mjv05022  Pathways of neurodegeneration - multiple diseases
mjv05132  Salmonella infection
mjv05134  Legionellosis
mjv05145  Toxoplasmosis
mjv05152  Tuberculosis
mjv05160  Hepatitis C
mjv05161  Hepatitis B
mjv05162  Measles
mjv05163  Human cytomegalovirus infection
mjv05164  Influenza A
mjv05167  Kaposi sarcoma-associated herpesvirus infection
mjv05168  Herpes simplex virus 1 infection
mjv05169  Epstein-Barr virus infection
mjv05170  Human immunodeficiency virus 1 infection
mjv05200  Pathways in cancer
mjv05210  Colorectal cancer
mjv05222  Small cell lung cancer
mjv05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108393483
   04215 Apoptosis - multiple species
    108393483
   04115 p53 signaling pathway
    108393483
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108393483
  09162 Cancer: specific types
   05210 Colorectal cancer
    108393483
   05222 Small cell lung cancer
    108393483
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108393483
   05012 Parkinson disease
    108393483
   05014 Amyotrophic lateral sclerosis
    108393483
   05016 Huntington disease
    108393483
   05017 Spinocerebellar ataxia
    108393483
   05020 Prion disease
    108393483
   05022 Pathways of neurodegeneration - multiple diseases
    108393483
  09166 Cardiovascular disease
   05416 Viral myocarditis
    108393483
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    108393483
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108393483
   05134 Legionellosis
    108393483
   05152 Tuberculosis
    108393483
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108393483
   05161 Hepatitis B
    108393483
   05160 Hepatitis C
    108393483
   05164 Influenza A
    108393483
   05162 Measles
    108393483
   05168 Herpes simplex virus 1 infection
    108393483
   05163 Human cytomegalovirus infection
    108393483
   05167 Kaposi sarcoma-associated herpesvirus infection
    108393483
   05169 Epstein-Barr virus infection
    108393483
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108393483
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108393483
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 108393483
NCBI-ProteinID: XP_017509779
LinkDB
Position
Unknown
AA seq 105 aa
MDDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGQKTGQAPGFCYTDANKNKGITW
GDETLMEYLENPKQYIPGTKMIFAGIKKSSERANLIAYLKKATKE
NT seq 318 nt   +upstreamnt  +downstreamnt
atggatgacgttgagaagggcaagaagatttttgttcagaaatgtgcccagtgccatact
gtggaaaagggaggcaagcacaagactgggccaaacctccatggtctgtttgggcaaaag
acaggtcaggcccctggattttgttacacagatgccaacaagaacaaaggcatcacctgg
ggagatgagacactgatggagtatttggagaatcccaagcagtacatccctggaacaaaa
atgatcttcgctggcattaagaagtcatcagaaagggccaacttgatagcttatctcaaa
aaagctactaaggagtaa

KEGG   Manis javanica (Malayan pangolin): 108396077
Entry
108396077         CDS       T06054                                 

Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01524  Platinum drug resistance
mjv04115  p53 signaling pathway
mjv04210  Apoptosis
mjv04215  Apoptosis - multiple species
mjv04932  Non-alcoholic fatty liver disease
mjv05010  Alzheimer disease
mjv05012  Parkinson disease
mjv05014  Amyotrophic lateral sclerosis
mjv05016  Huntington disease
mjv05017  Spinocerebellar ataxia
mjv05020  Prion disease
mjv05022  Pathways of neurodegeneration - multiple diseases
mjv05132  Salmonella infection
mjv05134  Legionellosis
mjv05145  Toxoplasmosis
mjv05152  Tuberculosis
mjv05160  Hepatitis C
mjv05161  Hepatitis B
mjv05162  Measles
mjv05163  Human cytomegalovirus infection
mjv05164  Influenza A
mjv05167  Kaposi sarcoma-associated herpesvirus infection
mjv05168  Herpes simplex virus 1 infection
mjv05169  Epstein-Barr virus infection
mjv05170  Human immunodeficiency virus 1 infection
mjv05200  Pathways in cancer
mjv05210  Colorectal cancer
mjv05222  Small cell lung cancer
mjv05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108396077
   04215 Apoptosis - multiple species
    108396077
   04115 p53 signaling pathway
    108396077
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108396077
  09162 Cancer: specific types
   05210 Colorectal cancer
    108396077
   05222 Small cell lung cancer
    108396077
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108396077
   05012 Parkinson disease
    108396077
   05014 Amyotrophic lateral sclerosis
    108396077
   05016 Huntington disease
    108396077
   05017 Spinocerebellar ataxia
    108396077
   05020 Prion disease
    108396077
   05022 Pathways of neurodegeneration - multiple diseases
    108396077
  09166 Cardiovascular disease
   05416 Viral myocarditis
    108396077
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    108396077
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108396077
   05134 Legionellosis
    108396077
   05152 Tuberculosis
    108396077
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108396077
   05161 Hepatitis B
    108396077
   05160 Hepatitis C
    108396077
   05164 Influenza A
    108396077
   05162 Measles
    108396077
   05168 Herpes simplex virus 1 infection
    108396077
   05163 Human cytomegalovirus infection
    108396077
   05167 Kaposi sarcoma-associated herpesvirus infection
    108396077
   05169 Epstein-Barr virus infection
    108396077
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108396077
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108396077
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 108396077
NCBI-ProteinID: XP_017514274
LinkDB
Position
Unknown
AA seq 105 aa
MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITW
GDETLMEYLENPKKYIPGTKMIFAGIKKSSERADLIAYLKTATKE
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggtgacgttgagaagggcaagaagatttttgttcagaaatgtgcccagtgccatact
gtggaaaagggaggcaagcacaagactgggccaaacctccatggtctgtttgggcgaaag
acaggtcaggcccctggattttcttacacagatgccaacaagaacaaaggcatcacctgg
ggagatgagacactgatggagtatttggagaatcccaagaagtacatccctggaacaaaa
atgatcttcgctggcattaagaagtcatcagaaagggccgacttgatagcttatctcaaa
acagctactaaggagtaa

DBGET integrated database retrieval system