KEGG   Manis javanica (Malayan pangolin): 108393793
Entry
108393793         CDS       T06054                                 

Gene name
ATF6B
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta isoform X1
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04022  cGMP-PKG signaling pathway
mjv04141  Protein processing in endoplasmic reticulum
mjv04151  PI3K-Akt signaling pathway
mjv04211  Longevity regulating pathway
mjv04261  Adrenergic signaling in cardiomyocytes
mjv04668  TNF signaling pathway
mjv04728  Dopaminergic synapse
mjv04911  Insulin secretion
mjv04915  Estrogen signaling pathway
mjv04918  Thyroid hormone synthesis
mjv04925  Aldosterone synthesis and secretion
mjv04926  Relaxin signaling pathway
mjv04927  Cortisol synthesis and secretion
mjv04928  Parathyroid hormone synthesis, secretion and action
mjv04934  Cushing syndrome
mjv04935  Growth hormone synthesis, secretion and action
mjv05020  Prion disease
mjv05030  Cocaine addiction
mjv05031  Amphetamine addiction
mjv05034  Alcoholism
mjv05161  Hepatitis B
mjv05163  Human cytomegalovirus infection
mjv05166  Human T-cell leukemia virus 1 infection
mjv05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    108393793 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    108393793 (ATF6B)
   04022 cGMP-PKG signaling pathway
    108393793 (ATF6B)
   04151 PI3K-Akt signaling pathway
    108393793 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    108393793 (ATF6B)
   04915 Estrogen signaling pathway
    108393793 (ATF6B)
   04926 Relaxin signaling pathway
    108393793 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    108393793 (ATF6B)
   04918 Thyroid hormone synthesis
    108393793 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    108393793 (ATF6B)
   04925 Aldosterone synthesis and secretion
    108393793 (ATF6B)
   04927 Cortisol synthesis and secretion
    108393793 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108393793 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    108393793 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    108393793 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    108393793 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    108393793 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    108393793 (ATF6B)
   05031 Amphetamine addiction
    108393793 (ATF6B)
   05034 Alcoholism
    108393793 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    108393793 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108393793 (ATF6B)
   05161 Hepatitis B
    108393793 (ATF6B)
   05163 Human cytomegalovirus infection
    108393793 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mjv03000]
    108393793 (ATF6B)
Transcription factors [BR:mjv03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    108393793 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf GIT_CC DUF4407 YabA ZapB
Other DBs
NCBI-GeneID: 108393793
NCBI-ProteinID: XP_017510368
LinkDB
Position
Unknown
AA seq 719 aa
MIGKGGSWEPSCGWGVGGKMAELMLLSEIADPTRFFTDNLLSPDDWDSTLYTGLDEVAEE
QTQLFCCPEQDVPFESNSLDVGMDVSPPEPPWDSLAVFPDLQVKSEPSSPCSSSSLSSES
SHLSTESSRQALGVREVLVVKTESLAPPLCLLGDDPTSPFETIQISVGPISDDPTDVQTK
IEPVSPSSSINSEASLLSAETPNQVFIGDEVLEVKTESPSPQACLLQDVPSPPLGTVHIS
MGTSPDGSSGKALPARKPPLQPKPVVITTVPMPPRAVPPSTTILLQPLVQPPPVSPVVLI
QGAIRVQPEGPAPAAPRPERKSIVPAPMPGNSCPPEVDTKLLKRQQRMIKNRESACQSRR
KKKEYLQGLEARLQAVLADNQQLHRENAVLRRRLEALLAENSELKLGSGNRKVVCIMVFL
LFIAFNFGPVSISEPPPAHVSPQMSGEQPRPQRHLLEFSAQESVLGVEALRGSSLRPEES
QPSPAGRPSFRNLTAFPGGTRELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQ
RGRRKVPQRAQERQKSQLWKKSPPVKAVPTQPLGAPERDSVGQLQLYRHPDRSQPEFLDA
IDRREDTFYVVSFRRDHLLLPAISHNKTSRPKMSLVMPAMAPNETLSGRGAPGDYEEMMQ
IECEVMDTRVIHIKTSTVPPSLRKQPSSTPGNATSGPLPVSTASQAHQASRRPLYLSHP
NT seq 2160 nt   +upstreamnt  +downstreamnt
atgatagggaagggcgggtcttgggaaccgtcttgtggttggggggtggggggaaagatg
gcggagctcatgctcctcagtgagattgcggatccgacgcgttttttcaccgacaacttg
ctgagcccggacgactgggacagcaccttgtacaccggtcttgatgaagtggctgaggag
cagactcagctcttctgctgccctgagcaggatgtcccgtttgaaagcaactccctggat
gtggggatggatgtcagtccccctgagcctccctgggactccctggctgttttcccagat
cttcaggtgaagtctgaaccatcctccccctgctcctcttcctctctcagttctgaatca
tcacatctttccacagagtcctccagacaggccctcggtgtaagggaggtgttagttgta
aagacggaatccttggcacccccactctgcctcctgggagatgatccaacatccccattt
gaaaccatccagatcagcgtgggccccatctctgatgatcccacagatgtccagaccaag
atagaacctgtctccccatcgtcctccatcaactctgaggcttccttgctctcagctgag
acccccaaccaggtttttataggagatgaggtactggaagtgaagacagagtctccatcc
cctcaagcatgtctcctgcaggatgtcccaagccccccacttggaactgtccacatcagc
atgggcacatcccctgatggctcctcaggcaaagccctgccggcccggaagccaccactg
cagcccaaacctgtggtgataaccactgtcccgatgccacccagagctgtgcctcccagc
accaccatccttttgcagccccttgtccagccacccccagtgtccccagttgtcctcatc
caaggtgctattcgagtccagcctgaggggccagcccctgctgctccacggcctgagagg
aagagcattgttccggctcctatgcctgggaactcctgcccacctgaagtggataccaag
ctactgaagcggcagcagcgaatgatcaagaaccgggagtccgcctgccaatcgcggagg
aaaaagaaagagtatctgcaggggctggaggctcggctgcaagccgtgctggctgacaat
cagcagctccaccgggagaatgctgtcctccggcggcggctggaggccctgctggcagag
aacagtgagctcaagttagggtctggaaacaggaaggtggtctgcatcatggtcttcctt
ctcttcattgccttcaactttgggcctgtcagcatcagtgagcctcccccggctcacgtc
tctcctcagatgagtggagagcagcctcgaccccagcgacacttgctggagttctcagca
caggagtcagttcttggagttgaagccctccggggctcctccctgcgacccgaggagtcc
cagcccagtcctgcaggccggccaagtttcaggaacctgacagccttccccgggggcacc
agggagctgctgctgagagacctggaccagctcttcctctcctctgattgccggcacttc
aatcgaactgaatctctgaggcttgctgatgagctgagtggctgggtccagcgccaccag
aggggccggcggaaggtcccccagagggcacaggagagacagaagtcgcagctatggaag
aagtctcctccagttaaggcagtccccacccaaccactgggggccccagaaagggattct
gtgggccaactacagctgtatcgccacccagaccgttcacagccagagttcctggatgca
attgaccgacgggaagacacattttatgttgtgtccttccgaagggaccacttgctgctc
ccagccatcagccacaacaagacctctcggcccaagatgtccttggtgatgcctgccatg
gccccaaatgagaccctgtcaggccggggggccccaggggactacgaggagatgatgcag
atcgagtgtgaggtcatggacaccagggtgattcacatcaagacctccacggtgcccccc
tcgctccgaaagcagccatcctcgaccccaggcaatgccacaagtgggcccctgccagtt
tctacagccagccaggcccaccaggcctcccgtcggcccctctacctcagtcacccctga

DBGET integrated database retrieval system