KEGG   Manis javanica (Malayan pangolin): 108394002
Entry
108394002         CDS       T06054                                 

Gene name
MSH6
Definition
(RefSeq) DNA mismatch repair protein Msh6
  KO
K08737  DNA mismatch repair protein MSH6
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01524  Platinum drug resistance
mjv03430  Mismatch repair
mjv05200  Pathways in cancer
mjv05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    108394002 (MSH6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108394002 (MSH6)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108394002 (MSH6)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108394002 (MSH6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mjv03400]
    108394002 (MSH6)
DNA repair and recombination proteins [BR:mjv03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     108394002 (MSH6)
SSDB
Motif
Pfam: MutS_V MutS_III MutS_I PWWP MutS_IV MutS_II
Other DBs
NCBI-GeneID: 108394002
NCBI-ProteinID: XP_017510725
LinkDB
Position
Unknown
AA seq 1362 aa
MSRQSTLYSFFPKSPALSNANKAPGRASDEGGGAAAAAATRASPSRGGDAVWSEDGPGPL
AGSAPSPEARNLNGGLRRAAARAVPASSCDFSPGDLVWAKMEGYPWWPCLVYNHPFDGTF
IREKGKSKSVRVHVQFFDDSPTRGWVSKRLLKPYTGSKSKEAQKGGHFYSEKPEILRAMQ
RADEALNKDKIKRLELAVCDEPSEPEEEETEVGATDASDKSGEDDEIESEEEVPPKVQGS
RRSSRQTKKRRVISDSESDIGGSDVEFKPDVKEEGSSDEISSGVGDSDSEGLDRAVKVAP
KRKRMVTGNGSLKKKSSKKEMSLATKRATGISSETKSTLSAFSASQNSDSQALISGGCDD
SSRPTIWYHETLEWLKEEKRRDVHRRRPDHPDFDASTLHVPEDFLNSCTPGMRKWWQIKS
QNFDLVIFYKVGKFYELYHMDALVGVSELGLVFMKGNWAHSGFPEIGFGRYSDSLVQKGY
KVARVEQTETPEMMEARCRKMAHISKYDRVVRREICRVITKGTQTYSVLEGDPSENYSKY
LLSLKEKEEDCSGHTRVYGVCFVDTSLGKFFIGQFSDDRHCSRFRTLVAHYPPVQVLFEK
GSLSAETKMVLKGSLSSSLQEGLIPGSQFWDAVKTLRTLLEEGYFTEKLNEKNGVMLPQV
LRGMTSESDSLGLTPGEKSELALSALGGCVFYLKKCLIDQELLSMANFEEYSPLDSGMVS
GTRPGAVFAKANQRMVLDAVTLNNLEIFLNGTNGSTEGTLLEKIDTCHTPFGKRLLKQWL
CAPLCNPYAINDRLDAIEDLMLVPDKISEVVDLLKKLPDLERLLSKIHNVGSPLKSQNHP
DSRAIMYEETTYSKKKIIDFLSALEGFKAVCTIIEIMEEVVDDFKSKILKQVITLKTKNP
EGRFPDLTVELNRWDTAFDHEKARKTGLITPKAGFDVDYDQALADIRENEQSLLEYLEKQ
RSRIGCRTIVYWGIGRNRYQLEIPENFITRNLPEEYELKSTKKGCKRYWTKTIEKKLANL
INAEERRDVSLKDCMRRLFYNFDKNYKDWQSAVECIAVLDVLLCLADYSRGGDGPMCRPV
ILFPEDTPPFLDLKGSRHPCITKTFFGDDFIPNDILIGCEEEEEENGKAYCVLVTGPNMG
GKSTLMRQAGLLAVMAQMGCYVPAEVCRLTPIDRVFTRLGASDRIMSGESTFFVELSETA
SILRHATVHSLVLVDELGRGTATFDGTAIANAVVKELAENIKCRTLFSTHYHSLVEDYSQ
NVAVRLGHMACMVENECEDPSQEMITFLYKFIKGACPKSYGFNAARLANLPEEVIQKGHR
KAREFETMTQSLRLFREVCLASEKSTVDAEAIHKLLTLIKQL
NT seq 4089 nt   +upstreamnt  +downstreamnt
atgtcgcgacagagcactctgtacagcttctttcccaaatctccggctctgagtaatgct
aacaaggcgccaggcagggcctcagacgaaggcggtggcgctgccgccgccgccgccacc
cgagcctccccttcccgcggcggggatgcggtctggagcgaggacgggcctgggcccttg
gcgggttccgcgccgtcgcccgaggcgaggaacctcaacggaggtctccggagggcggca
gcgcgggcagtccccgccagttcttgtgacttctcaccaggcgatttggtttgggccaag
atggagggttacccttggtggccttgtttggtttacaaccacccttttgatggaacattc
atccgtgagaagggcaagtctaagtctgttcgagttcatgtacagttttttgatgacagc
ccaacaaggggctgggttagcaaaaggctattaaagccgtatacaggttcaaaatcgaag
gaggcccagaaaggaggtcatttttatagtgaaaagcctgaaatactcagagcaatgcaa
cgtgcagatgaagccttgaataaagacaagattaagaggctcgagttggcagtgtgtgat
gagccctcagaaccagaggaggaagagacggaggtaggtgcaactgatgcatcagataag
agtggagaagatgatgaaattgagagtgaagaggaagtgccacctaaggtgcaaggatct
aggcgtagtagccgtcaaacaaaaaaacgaagggtcatatcagactctgagagtgacatt
ggtggctcagatgtggaattcaagccagatgtaaaggaggaaggaagcagtgatgaaata
agcagtggagtaggggacagtgacagtgaaggcctagacagagctgtcaaagttgctcca
aagcggaagagaatggtgactggaaatggctccctgaaaaagaaaagttcaaagaaggaa
atgtccttagccaccaaacgagcaactggcatttcatcagaaaccaagagtactttgagt
gctttttctgcctctcaaaattctgactcccaagccctcattagtggaggatgtgatgac
agtagtcgccccactatctggtatcacgaaactttagaatggcttaaagaggaaaagaga
agagatgtgcacaggaggcgtcctgatcaccctgattttgatgcatctacactccacgtg
cctgaggatttccttaattcctgtactcctggcatgagaaagtggtggcaaattaaatct
caaaactttgatcttgttatattttataaggtggggaaattttatgagctgtatcacatg
gatgctcttgttggagtcagtgaattagggctggtattcatgaaaggcaactgggctcat
tctggtttccctgaaattggatttggccgatactcagattccctggtccagaaaggctat
aaagtagcacgagtggaacagactgagaccccggaaatgatggaggcacgatgccgaaag
atggcacacatatctaagtatgatagagtagtgaggagggaaatctgtagggtcataacg
aagggcacgcagacctacagtgtgctggaaggtgacccctctgagaactacagcaaatat
cttcttagcctcaaggaaaaggaggaagattgttctggccacactcgagtgtatggtgtg
tgctttgttgatacttcactgggcaaatttttcataggtcagttttcagatgaccgccat
tgttccaggtttaggactctagtggcacattatcctccagtgcaagtcttgtttgagaaa
ggcagtctctcagcagaaacgaagatggttctgaagggctcattatcctcttctcttcag
gaaggcctgataccaggctcccagttttgggatgcagtcaaaactttgagaactctcctt
gaagaagggtattttacagaaaagttaaatgagaaaaatggggtgatgttgccccaagtg
cttagaggcatgacatcagagtctgattctcttgggttgacaccaggagagaaaagtgaa
ttggccctctctgctctaggtggttgtgtcttctacctcaaaaaatgccttattgatcaa
gagcttttatcaatggctaattttgaagaatatagtcccttggattctggcatggtcagt
ggtacaagacctggtgctgtttttgctaaagccaatcaacgaatggtgctagatgctgta
acactgaacaacttggagatttttctgaatggcacgaatggttctaccgaaggaactctg
ctagagaagattgatacttgccatactccttttggtaagcggctcctaaagcaatggctt
tgtgccccactctgtaacccttatgctatcaatgatcgtctggatgccatagaagacctc
atgcttgtgcctgacaaaatctctgaggttgtagaccttctaaaaaagcttccagacctt
gagaggctactaagtaaaattcataatgttgggtctcccctcaagagccagaaccaccca
gatagcagggctataatgtatgaagaaacgacatacagcaaaaaaaagataattgatttt
ctttctgctctagaaggattcaaagcagtatgtacaattatagagattatggaagaagtt
gttgatgactttaagtctaaaatacttaagcaggttattactctgaagacaaaaaatcct
gaaggccggttccctgatttgactgtagaattgaaccgatgggatacagcctttgatcat
gaaaaggctcgaaagactggactcattactcccaaagcaggatttgatgtggattatgac
caggctcttgctgacataagagaaaatgaacagagcctcctggaatacttggagaaacag
cgcagtcgaattggctgtaggaccatagtctattgggggatcggtaggaaccgttaccag
ttggaaattccagagaatttcatcacccgtaatttgccagaagaatatgagttgaaatcc
accaagaagggctgtaaacgatactggaccaaaactattgagaagaagttggcaaatctg
ataaatgctgaagaacggagagatgtgtcattgaaggactgtatgcggcgactattctat
aactttgataaaaattacaaggactggcagtctgctgtagagtgcatcgcagtgttagat
gtcttattgtgcctggctgactacagtcgagggggtgatggccctatgtgtcgcccagta
attctctttccagaagacactccccccttcttagaccttaaaggatcacgccatccctgc
attacaaagactttttttggagatgactttattcctaatgacattttaataggctgtgag
gaagaggaggaggaaaatggcaaagcttattgtgtgcttgttactggaccaaacatgggt
ggcaaatctacactcatgagacaggctggcctattagctgtaatggcccagatgggttgt
tatgtacctgctgaagtatgtaggctcacaccaattgatagagtgtttactagacttggt
gcttcagacagaataatgtcaggtgaaagcacattttttgttgaattgagtgaaactgcc
agtatacttagacatgcaacagtacattccctggtgcttgtggatgaattaggaagaggt
actgcaacatttgatgggacagcaatagcaaatgcagttgttaaggaacttgctgagaat
ataaagtgtcgtacactgttttctacccactaccattcattagttgaagattattctcaa
aatgttgcagtgcgcctaggacacatggcatgcatggtagaaaacgaatgtgaagatccc
agccaggagatgattaccttcctctataaattcattaagggagcttgtcctaaaagctat
ggctttaacgcagcaaggcttgctaatcttccagaggaggttattcagaaggggcataga
aaagcaagagaattcgagacgatgactcagtcactgcgattgtttcgggaagtttgcctg
gctagtgaaaagtcgactgtagatgctgaagctatccataagttgctgactttgattaag
caattatag

DBGET integrated database retrieval system