KEGG   Manis javanica (Malayan pangolin): 108394148
Entry
108394148         CDS       T06054                                 

Gene name
TGFBR1
Definition
(RefSeq) TGF-beta receptor type-1
  KO
K04674  TGF-beta receptor type-1 [EC:2.7.11.30]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04010  MAPK signaling pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04068  FoxO signaling pathway
mjv04144  Endocytosis
mjv04218  Cellular senescence
mjv04350  TGF-beta signaling pathway
mjv04371  Apelin signaling pathway
mjv04380  Osteoclast differentiation
mjv04390  Hippo signaling pathway
mjv04520  Adherens junction
mjv04659  Th17 cell differentiation
mjv04926  Relaxin signaling pathway
mjv04933  AGE-RAGE signaling pathway in diabetic complications
mjv05142  Chagas disease
mjv05161  Hepatitis B
mjv05166  Human T-cell leukemia virus 1 infection
mjv05200  Pathways in cancer
mjv05210  Colorectal cancer
mjv05212  Pancreatic cancer
mjv05220  Chronic myeloid leukemia
mjv05225  Hepatocellular carcinoma
mjv05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108394148 (TGFBR1)
   04350 TGF-beta signaling pathway
    108394148 (TGFBR1)
   04390 Hippo signaling pathway
    108394148 (TGFBR1)
   04371 Apelin signaling pathway
    108394148 (TGFBR1)
   04068 FoxO signaling pathway
    108394148 (TGFBR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108394148 (TGFBR1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    108394148 (TGFBR1)
  09143 Cell growth and death
   04218 Cellular senescence
    108394148 (TGFBR1)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    108394148 (TGFBR1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    108394148 (TGFBR1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    108394148 (TGFBR1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108394148 (TGFBR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108394148 (TGFBR1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108394148 (TGFBR1)
   05212 Pancreatic cancer
    108394148 (TGFBR1)
   05225 Hepatocellular carcinoma
    108394148 (TGFBR1)
   05226 Gastric cancer
    108394148 (TGFBR1)
   05220 Chronic myeloid leukemia
    108394148 (TGFBR1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    108394148 (TGFBR1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108394148 (TGFBR1)
   05161 Hepatitis B
    108394148 (TGFBR1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    108394148 (TGFBR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mjv01001]
    108394148 (TGFBR1)
Enzymes [BR:mjv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     108394148 (TGFBR1)
Protein kinases [BR:mjv01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   108394148 (TGFBR1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr TGF_beta_GS Activin_recp Pkinase_fungal APH FTA2
Other DBs
NCBI-GeneID: 108394148
NCBI-ProteinID: XP_017511002
LinkDB
Position
Unknown
AA seq 527 aa
MTSRIWAALGTLTAQSSSRGSPSISPVTHLLAQHQPSIWSFSPVYYRFHLCHKSRSCISL
QCFCHLCTKDNFTCVTDGLCFVSVTETTDKVIHNSMCIAKIDLIPRDRPFVCAPSSKTGS
LTHCCNEDHCNKIELPTVGKPSTGLGPVELAAVIAGPVCFVCISLMLMVYICHNRTVIHH
RVPNEEDPSLDRPFISEGTTLKDLIYDMTTSGSGSGLPLLVQRTIARTIVLQESIGKGRF
GEVWRGKWRGEEVAVKIFSSREERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQL
WLVSDYHEHGSLFDYLNRYTVTVEGMIKLALSTASGLAHLHMEIVGTQGKPAIAHRDLKS
KNILVKKNGTCCIADLGLAVRHDSATDTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESF
KRADIYAMGLVFWEIARRCSIGGIHEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPN
RWQSCEALRVMAKIMRECWYANGAARLTALRIKKTLSQLSQQEGIKM
NT seq 1584 nt   +upstreamnt  +downstreamnt
atgacttcaagaatctgggctgctttgggaaccctcactgcccaatcttcctccaggggc
tcaccgtccatttccccagtcactcatcttcttgcccaacaccagccttcaatttggtcc
ttttccccagtgtactacaggtttcacctttgtcataaatcaaggagctgtatatcatta
cagtgtttctgccacctttgtacaaaagacaattttacttgtgtcacagatgggctctgc
tttgtctctgtcacagagaccacagacaaagttatacacaatagcatgtgtatagctaaa
attgacctgattcctcgagacaggccatttgtatgtgcaccatcttcaaaaactgggtct
ctaacacattgctgcaatgaggaccattgcaataaaatagaactcccaactgttggaaag
ccatcaactggccttggtcccgttgagttggcagccgtcattgctggaccagtctgcttc
gtctgcatctccctcatgttgatggtctatatctgccataaccgcaccgtcattcaccat
cgagtgccaaatgaagaggatccttctttagatcgcccttttatttcagagggtactacg
ttaaaagatttaatttatgatatgacaacatcaggttctggatcaggtttaccattgctt
gttcaacgaacaattgcaagaactattgtgttacaagaaagtattggcaaaggtcgattt
ggagaggtttggcgaggaaagtggagaggagaagaagttgctgttaaaatattctcctct
agagaagaacgttcatggttccgtgaggcagagatttatcaaaccgtaatgttacgtcat
gaaaacatcttgggatttatagcagcagacaataaagacaatggtacatggactcagctc
tggttggtgtcagattatcacgagcatggatctctttttgattacttgaatagatacaca
gttacagtggagggaatgatcaaacttgctttgtccacagcaagtggacttgcccatctt
catatggagattgttggtacccaaggtaaaccagccattgctcatagagatttaaagtca
aagaatatcttggtaaagaagaatggaacttgttgtattgcagatttagggctggcggta
agacacgattcagccacagatacaattgatattgctccaaaccacagagtgggaacaaaa
aggtacatggcccctgaggttctagatgattccataaatatgaaacactttgaatccttc
aaacgtgctgacatctatgcaatgggcttagtcttctgggaaatagctcgacgatgttcc
attggtggaattcatgaagattaccagctgccttattatgatcttgtaccttctgatcca
tcagttgaagaaatgagaaaagttgtttgtgaacagaagttaaggccaaatattccaaac
agatggcagagctgtgaagctttgagagtaatggctaaaattatgagagaatgttggtac
gccaatggagcagctaggcttacagctttgcggattaagaaaacattgtcacagctcagt
caacaggaaggcatcaaaatgtaa

DBGET integrated database retrieval system