KEGG   Manis javanica (Malayan pangolin): 108394315
Entry
108394315         CDS       T06054                                 

Gene name
EP300
Definition
(RefSeq) histone acetyltransferase p300
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04024  cAMP signaling pathway
mjv04066  HIF-1 signaling pathway
mjv04068  FoxO signaling pathway
mjv04110  Cell cycle
mjv04310  Wnt signaling pathway
mjv04330  Notch signaling pathway
mjv04350  TGF-beta signaling pathway
mjv04520  Adherens junction
mjv04630  JAK-STAT signaling pathway
mjv04720  Long-term potentiation
mjv04916  Melanogenesis
mjv04919  Thyroid hormone signaling pathway
mjv04922  Glucagon signaling pathway
mjv04935  Growth hormone synthesis, secretion and action
mjv05016  Huntington disease
mjv05152  Tuberculosis
mjv05161  Hepatitis B
mjv05164  Influenza A
mjv05165  Human papillomavirus infection
mjv05166  Human T-cell leukemia virus 1 infection
mjv05167  Kaposi sarcoma-associated herpesvirus infection
mjv05200  Pathways in cancer
mjv05203  Viral carcinogenesis
mjv05206  MicroRNAs in cancer
mjv05211  Renal cell carcinoma
mjv05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    108394315 (EP300)
   04330 Notch signaling pathway
    108394315 (EP300)
   04350 TGF-beta signaling pathway
    108394315 (EP300)
   04630 JAK-STAT signaling pathway
    108394315 (EP300)
   04066 HIF-1 signaling pathway
    108394315 (EP300)
   04068 FoxO signaling pathway
    108394315 (EP300)
   04024 cAMP signaling pathway
    108394315 (EP300)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108394315 (EP300)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    108394315 (EP300)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    108394315 (EP300)
   04935 Growth hormone synthesis, secretion and action
    108394315 (EP300)
   04919 Thyroid hormone signaling pathway
    108394315 (EP300)
   04916 Melanogenesis
    108394315 (EP300)
  09156 Nervous system
   04720 Long-term potentiation
    108394315 (EP300)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108394315 (EP300)
   05206 MicroRNAs in cancer
    108394315 (EP300)
   05203 Viral carcinogenesis
    108394315 (EP300)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    108394315 (EP300)
   05215 Prostate cancer
    108394315 (EP300)
  09164 Neurodegenerative disease
   05016 Huntington disease
    108394315 (EP300)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    108394315 (EP300)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108394315 (EP300)
   05161 Hepatitis B
    108394315 (EP300)
   05164 Influenza A
    108394315 (EP300)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108394315 (EP300)
   05165 Human papillomavirus infection
    108394315 (EP300)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mjv03000]
    108394315 (EP300)
   03036 Chromosome and associated proteins [BR:mjv03036]
    108394315 (EP300)
   03029 Mitochondrial biogenesis [BR:mjv03029]
    108394315 (EP300)
Enzymes [BR:mjv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     108394315 (EP300)
Transcription factors [BR:mjv03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    108394315 (EP300)
Chromosome and associated proteins [BR:mjv03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    108394315 (EP300)
Mitochondrial biogenesis [BR:mjv03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    108394315 (EP300)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 108394315
NCBI-ProteinID: XP_017511286
LinkDB
Position
Unknown
AA seq 2354 aa
MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGD
ISQLQTSLGIVQDAASKHKQLSELLRSGSSPNLNMGVGGPGQGMASQAPQNSPGLGLINS
MVKSPMAQAGLTSPNMGMGTSGPNQGPTPSATGMMNSPVNQPAMGMNTGMNAGMNPGMLN
AGNGQGMLPNQVMNGSIGAGRGRPNMQYPNPGMGNAGNLMTEPLQQGSTQMGGQAGLRGP
QPLKMGMMNNPNPYSSPYTQNSGQQLGASGLGLQIQAKSVLPNSLSPFAMDKKTVPGGGM
PNMGQQQAPQVQQPGLVAPVAPGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANG
EVRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKN
AGDKRNQQSILTGAPVGLGNTSSLGVGQQSAPSLSTVSQIDPSSIERAYAALGLPYQVNQ
MPTQPQVQAKSQQNQQSGQSPQGMRPMSNMSASPMGVNGGVGVQTSNLLSDSMLHSAINS
QNPMMSENASVTSLGPMPTAAQPSSTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAA
LKDRRMENLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMLP
SAAGMVPVSMNAGPNMGQPQPGMNSNGPLPDPSMIRGSVPNQMMPRITPQPGLNQFGPMS
MPQPPIGPRQTSPLQHHGQLAQPGALNPPMGYGPRMQQPSSQSQFLPQAQFSAQGMSVTN
MPLAPSGGQAPVSQAQMSSSSCPVNSPIMPPGSQGGHIHCPPLPQSALHQNSPSPVPSRT
PTPHHTPPSIGAQQPPAPAIPAPVPTPPAMTTGPQSQALHPPPRQTPTPPPTQPPPQGQP
SLPAAPVADPPPQQPLSQQSTAASVPTPSAPLLPPQPVTPLSQPAVSIEGQVSDPPSTSS
TEVNSQIIPEKQPSQEVKMEAKMEVDQPEPADTQPEDIPETKAEGCKVEPTETEERGPEL
KIEPKEEEDQPSTSATQSSPAPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPV
DPQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVY
KYCSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYH
FCEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICV
LHHEIIWPSGFVCDGCLKKTARTRKENKFSAKRLPSTRLGTFLENRVNDFLRRQNHPESG
EVTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQ
EYGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACP
PSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDIFKQATEDRLTSAK
ELPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNKKTSKN
KSSLSRGNKKKPGMPSVSNDLSQKLYATMEKHKEVFFVIRLIAGPAANSLPPIVDPDPLI
PCDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHVET
RWHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNSQQAAATQSPGDSRRLSIQRCI
QSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQEN
KCPVPFCLNIKQKLRQQQLQHRLQQAQMLRRTPAAGPVSQGKAAGPVTPPTPPQTAQPPL
PGPPPAAVEMAMQIQRAAETQRQMAHVQIFQRPIQHQMPQMTPMAPMGMNPPPMARGPSG
HLEPGMGPTGMQQQPPWAQGGGPQPQQLQSGMPRPAMMSVAQHGQPLNMAPQPGLGQVGV
SPLKPGTVSQQALQNLLRTLRSPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYASSNPQ
SLPGQPAMPQGQPGLQPPAVPGQQGVHSSPAMQNVSPMQAGVQRAGLPPQQPQQPLQPPL
GGMSPQAQQVNVNHSTMPSQFRDILRRQQMMQQQGAGPGLGPGMTNHSQFPQPQGVGYAP
PPQQPRMQHHMQQMQQGSLGQMGQLPPALGAEAGASLQAYQQRLLQQQMGSPAQPNPMSP
QQHMLPNQAQSPHLQGQQIPSSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQPSPHHV
SPQTSSPHPGLVAAQANPMEQGHFASPDQNSMLSQLASNPGMANLHGASATDLGLSTDNS
DLNPNLSQSTLDIH
NT seq 7065 nt   +upstreamnt  +downstreamnt
atggccgagaatgtggtggaaccggggccgccttcagccaagcggcctaaactctcatct
ccggccctctcggcgtcggccagcgatggcacagattttggctctctatttgacttggag
catgacttaccagatgaattaatcaactctacagaattgggactaaccaatggtggtgat
attagtcagcttcagacaagtcttggcatagtacaagatgcagcctctaaacataaacaa
ctgtcagaattgctacgatctggcagttccccaaacctcaatatgggggttggtggccca
ggtcaaggtatggccagccaggccccacaaaacagtcctggattaggtttgataaatagc
atggtaaaaagcccaatggcacaggcaggcttgacttctcccaacatggggatgggcact
agtggaccaaatcagggtcccacgccatctgcaacaggtatgatgaacagtccagtaaat
caacctgccatgggaatgaacacagggatgaatgctggcatgaatcctggaatgttgaat
gcaggcaatggacaggggatgctgcctaatcaagtcatgaacggttcaattggagcaggc
cgggggcgacctaacatgcagtacccaaacccaggcatgggaaatgctggcaacttaatg
actgagccactgcagcaaggctctacccagatgggaggacaagcaggattgagaggcccc
cagcctcttaagatgggaatgatgaacaaccccaatccttacagttcaccatatactcag
aattctggacagcagcttggagccagtggcctcggtctccagattcaggcaaagtctgta
cttccaaatagcttatcaccatttgcgatggacaaaaagacagttcctggtggaggaatg
cccaacatgggccaacagcaagccccccaggtccagcagccaggccttgtggctccggta
gccccgggaatgggttctggagcgcacacagctgacccagagaagcgcaagctcatccag
cagcagcttgtcctcctcttgcacgctcacaagtgccagcgccgggagcaggctaacggg
gaagtgaggcagtgcaaccttccccactgtcgcaccatgaagaacgtcctgaaccacatg
acacactgccagtcaggcaagtcctgccaagtggcacactgtgcatcttctcgacaaatc
atttcacactggaagaattgtacaaggcatgactgtcctgtgtgtctcccccttaaaaat
gctggggataaaagaaaccaacagtcaattttgactggagcaccagttggacttggaaat
actagctctctaggggtgggtcagcagtctgcccccagcctaagcactgtcagtcagatt
gaccccagctctatagaaagagcctacgcagctcttggactcccctatcaagtaaatcag
atgccaacacagccccaggtgcaagcaaagtcccagcagaatcagcagtctgggcagtct
ccccaaggcatgcggcccatgagcaacatgagtgctagtcctatgggagtaaatggaggt
gtaggggttcaaacgtcaaatcttctgtctgactcaatgttgcattcagccataaattct
caaaacccaatgatgagtgaaaatgccagtgtgacctccctgggtcctatgccaacagca
gctcagccatccagtactggaattcggaaacaatggcatgaagatattactcaggatctt
cgaaatcatcttgttcacaaacttgttcaagccatatttcctactccggatcctgctgct
ttaaaagacagacggatggaaaacctagttgcatatgcccggaaagtggaaggggacatg
tatgaatctgcaaataatcgagcggaatactaccacctgctagctgagaagatctataag
atccagaaagaactggaagaaaaacgaaggactagactacagaaacaaaatatgctacca
agtgctgcaggcatggtgccagtttccatgaacgcagggcctaacatggggcagccgcaa
ccaggaatgaattctaatggccctctgcctgatccatctatgatccgtggcagtgtgcca
aaccagatgatgcctcggataactccacagcctggtttgaatcaatttgggccgatgagt
atgccccagccgcctattgggccccggcagacctctcctcttcagcaccatggacagtta
gctcagcctggagctctcaacccacctatgggctatgggcctcgcatgcaacagccttcc
agccagagccagttccttccccaggctcagttctcagcacagggaatgagtgtgacgaat
atgcctttggctccgtctggcggtcaagcacccgtgtctcaagcacaaatgtccagttct
tcctgccctgtgaactctcctattatgcctccagggtctcaaggtggccacattcactgt
ccccctctccctcagtcagctctgcatcagaactcaccttctcctgtacccagtcgtacc
cccacgcctcaccatacgcccccaagcataggggctcagcagccgccagcaccagcaatt
ccagctcctgttcctacacctccagccatgacgactgggccccagtcacaggcactgcat
ccacctccaaggcagacacctacaccaccaccaacgcaacctcctccccaagggcagcct
tcacttccggctgctcctgtagctgacccgccaccacagcagcctctttcacagcagagt
acagcagcctccgttcccaccccatcggcaccattgctgcctccacagcctgtgactcca
ctttcccaaccagctgtaagcattgaagggcaggtatcagaccctccatctactagtagc
acagaagtgaattctcagatcattcctgagaagcagccttcacaggaagtgaaaatggag
gctaaaatggaagtggatcaaccagagccagcagatactcagccagaggatattccagag
actaaagcagaaggctgtaaggtggaacctacagaaacagaagaaagaggccctgaacta
aaaattgaaccaaaagaggaggaagaccagccaagtacttccgctacccaatcatctcca
gccccgggacagtcaaagaagaagattttcaaaccagaagagttacgacaggcactgatg
ccaacgttggaggcactttaccgacaggatccagaatcccttccctttcggcagcctgtg
gaccctcagcttctaggaatcccagattactttgatattgtgaaaagccccatggatctt
tctaccatcaagaggaagttagacactggacagtatcaggaaccctggcagtatgtggat
gacatctggcttatgttcaacaatgcctggttatataatcggaaaacatcacgggtgtac
aaatactgctcgaagttgtctgaggtctttgaacaagaaattgatccagtcatgcaaagc
cttggatattgttgtggcagaaagttggagttttccccacagacactctgttgctatggc
aaacagttatgcacaatcccccgggatgccacttactacagttaccagaacaggtatcat
ttctgtgagaagtgtttcaatgaaatccaaggggagagcgtttctttgggggatgaccct
tcccaacctcaaactacaataaataaagaacaattttccaagagaaaaaatgacacactg
gatcctgaactgtttgttgaatgtacagagtgtggaagaaagatgcatcaaatctgtgtc
cttcatcatgaaatcatctggccatcgggatttgtctgtgatggctgtttaaagaaaact
gcacgaactaggaaagaaaataagttttctgctaaaaggttgccatctaccaggcttggc
acctttttggagaatcgtgtgaatgactttctaaggcgacaaaatcaccctgaatcagga
gaggtcactgttcgagtagttcatgcttctgacaaaactgtggaagtgaagccgggcatg
aaagcaaggtttgtagacagtggagagatggcagaatcctttccgtatcgaaccaaagcc
ctctttgcctttgaagagatcgatggtgtcgacttgtgcttctttggcatgcatgtccaa
gagtacggctccgactgccctccacccaaccagaggagagtatacatatcataccttgat
agtgttcatttcttccgtcccaaatgcttgaggactgcggtctatcatgaaattctaatt
ggatatttagaatacgtcaagaaattaggatatacaacagggcatatttgggcatgtccc
ccaagtgaaggagacgactatatcttccattgccatcctcctgaccagaagatacccaag
cccaagcgcctgcaggagtggtataaaaagatgctcgacaaggctgtgtctgagcgcatc
gtccatgactacaaggatatttttaaacaagctactgaagatcggttaacaagtgcaaag
gaactgccttactttgaaggtgacttctggcccaatgttctggaggagagcatcaaggag
ctggagcaggaggaagaagagagaaagcgagaggaaaacaccagcaatgagagcacagat
gtaacaaagggagacagcaaaaatgctaaaaagaaaaacaacaagaaaaccagcaaaaac
aagagcagcctgagtaggggcaacaagaagaagccaggcatgcccagtgtatccaatgac
ctctcgcagaagctgtacgccaccatggagaagcataaagaggtcttctttgtgatccgt
ctcattgccggccctgctgccaactccctgcctcccattgttgatcctgacccccttatc
ccctgtgatctgatggatgggcgggatgcctttctcacccttgcaagggataagcacctg
gagttctcttcactccgaagagcccagtggtccaccatgtgcatgctggtggagctgcac
actcagagccaggaccgctttgtctacacctgcaatgagtgcaagcaccacgtggaaact
cgctggcactgcaccgtgtgcgaggattatgatttgtgtatcacctgttataacactaaa
aaccacgaccataagatggagaagctaggtctcggcctagatgacgagagcaacagccag
caggccgcggccacgcagagcccaggagactcccgccgcctgagcatccagcgctgcatc
cagtccctggtgcacgcctgccagtgccgcaacgccaactgctcgctgccctcctgccag
aagatgaagcgggttgtgcagcacaccaagggctgtaagcggaaaaccaacgggggctgc
cccatctgcaagcagctcatcgccctctgctgctaccatgccaagcactgccaggagaac
aagtgcccggtgcccttttgcctcaacatcaagcagaagctccgccagcagcagctgcag
caccggctgcaacaggcgcagatgctgcgcaggacaccagcggctggccctgtgtcccag
gggaaggctgccggcccggtgacccccccaacacccccccagactgctcagccgcccctt
ccggggcccccacctgcagcagtggagatggcaatgcaaattcagagggccgcagaaacg
cagcgccagatggcccacgtgcagattttccagaggccgatccagcaccagatgccccaa
atgactcccatggcccccatgggtatgaacccaccccccatggccagaggtcccagcgga
catttggagccagggatggggcccacagggatgcagcagcagccaccgtgggcccaggga
ggagggcctcagccccagcagctgcagtccgggatgccaaggccagccatgatgtcagtg
gcccagcacggtcagcccttgaacatggctccccagccaggattgggccaggtaggtgtg
agccctctcaaaccaggcactgtgtctcaacaagccttacaaaaccttttgcggactctc
aggtctcccagctctcccctacagcagcaacaggtgcttagtatccttcacgccaacccc
cagctgttggctgcgttcatcaagcagcgggctgccaagtatgccagctctaacccgcag
tccctccctgggcagccggccatgccgcagggccagccagggcttcagccgcctgccgtg
ccaggtcagcagggggtgcactccagtcctgccatgcagaatgtgagccccatgcaggcg
ggtgtgcagagggccggcctgcccccgcagcagccgcagcagccgctccagccgcccctg
ggagggatgagcccccaggctcagcaggtgaacgtcaatcacagcaccatgccttcgcag
ttccgggacatcttgagacgacagcaaatgatgcagcagcagggagcagggccaggcttg
ggccctgggatgaccaaccatagccagttcccacagccccagggagttggctacgcgcca
ccgccacagcagccacggatgcagcatcacatgcagcaaatgcagcaagggagcctagga
cagatgggccagcttcccccggccctgggagcagaggccggagccagtctgcaagcctat
cagcagcgactcctccagcagcagatggggtcccctgctcagcccaaccccatgagtccc
cagcagcatatgctcccaaaccaggctcagtccccgcacctgcaaggccagcagatccct
tcttctctctccaatcaagtgcgttcaccccagcctgtcccttcaccgcggccgcagtcc
cagcccccccactccagcccttccccaaggatgcagcctcagccttctccacaccacgtt
tccccacagaccagttctccacaccctggactggtagctgcccaggccaaccccatggaa
caagggcattttgccagcccggaccagaattcaatgctttctcagctcgctagcaatcca
ggcatggcaaacctccatggtgcaagcgccacggacctgggactcagcaccgataactca
gacttgaatccaaacctctcacagagtacactagacatacactag

KEGG   Manis javanica (Malayan pangolin): 108395362
Entry
108395362         CDS       T06054                                 

Gene name
CREBBP
Definition
(RefSeq) CREB-binding protein
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04024  cAMP signaling pathway
mjv04066  HIF-1 signaling pathway
mjv04068  FoxO signaling pathway
mjv04110  Cell cycle
mjv04310  Wnt signaling pathway
mjv04330  Notch signaling pathway
mjv04350  TGF-beta signaling pathway
mjv04520  Adherens junction
mjv04630  JAK-STAT signaling pathway
mjv04720  Long-term potentiation
mjv04916  Melanogenesis
mjv04919  Thyroid hormone signaling pathway
mjv04922  Glucagon signaling pathway
mjv04935  Growth hormone synthesis, secretion and action
mjv05016  Huntington disease
mjv05152  Tuberculosis
mjv05161  Hepatitis B
mjv05164  Influenza A
mjv05165  Human papillomavirus infection
mjv05166  Human T-cell leukemia virus 1 infection
mjv05167  Kaposi sarcoma-associated herpesvirus infection
mjv05200  Pathways in cancer
mjv05203  Viral carcinogenesis
mjv05206  MicroRNAs in cancer
mjv05211  Renal cell carcinoma
mjv05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    108395362 (CREBBP)
   04330 Notch signaling pathway
    108395362 (CREBBP)
   04350 TGF-beta signaling pathway
    108395362 (CREBBP)
   04630 JAK-STAT signaling pathway
    108395362 (CREBBP)
   04066 HIF-1 signaling pathway
    108395362 (CREBBP)
   04068 FoxO signaling pathway
    108395362 (CREBBP)
   04024 cAMP signaling pathway
    108395362 (CREBBP)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108395362 (CREBBP)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    108395362 (CREBBP)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    108395362 (CREBBP)
   04935 Growth hormone synthesis, secretion and action
    108395362 (CREBBP)
   04919 Thyroid hormone signaling pathway
    108395362 (CREBBP)
   04916 Melanogenesis
    108395362 (CREBBP)
  09156 Nervous system
   04720 Long-term potentiation
    108395362 (CREBBP)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108395362 (CREBBP)
   05206 MicroRNAs in cancer
    108395362 (CREBBP)
   05203 Viral carcinogenesis
    108395362 (CREBBP)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    108395362 (CREBBP)
   05215 Prostate cancer
    108395362 (CREBBP)
  09164 Neurodegenerative disease
   05016 Huntington disease
    108395362 (CREBBP)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    108395362 (CREBBP)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108395362 (CREBBP)
   05161 Hepatitis B
    108395362 (CREBBP)
   05164 Influenza A
    108395362 (CREBBP)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108395362 (CREBBP)
   05165 Human papillomavirus infection
    108395362 (CREBBP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mjv03000]
    108395362 (CREBBP)
   03036 Chromosome and associated proteins [BR:mjv03036]
    108395362 (CREBBP)
   03029 Mitochondrial biogenesis [BR:mjv03029]
    108395362 (CREBBP)
Enzymes [BR:mjv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     108395362 (CREBBP)
Transcription factors [BR:mjv03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    108395362 (CREBBP)
Chromosome and associated proteins [BR:mjv03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    108395362 (CREBBP)
Mitochondrial biogenesis [BR:mjv03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    108395362 (CREBBP)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 108395362
NCBI-ProteinID: XP_017513045
LinkDB
Position
Unknown
AA seq 2100 aa
MGQNXIALLSYCRRQPNGDSLTSQMQTSVGIVPTQAIATGPTADPEKRKLIQQQLVLLLH
AHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWKNCT
RHDCPVCLPLKNASDKRNQQTILGSPASGIQNTLGSVGAGQQNATSLSNPNPIDPSSMQR
AYAALGLPYLNQPQTQLQPQVPGQQPAQPQTHQQMRTLNPLGNNPINIPAGGITADQQPP
NLISESALPTSLGATNPLMNDSASSGSIGALSTIPTAAPPSSTGVRKSWHEHVTQDLRSH
LVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYYHLLAEKIYKIQK
ELEEKRRSRLHKQGILGNQPALPTPATQPPGIPQAQTVRPPNGPMPLPVNRMQVSQGMNS
FTPMSLGNVQLPQAPMGPRAASPMNHSVPMSSMGSVPGMAVSPSRVPQPPNMMGAHAGNM
MAQAPAQSQFLPQSQFPSSGGAMSVNSVGMGQPAAQTGVSQGQVPGAALPNALNMLGPQA
SQLPCPPVTQSPLHQTPPPAPATVAMPALQHPPAPGMTPPQPAAPTQPSTPVSSSGQTPT
PTPGSVPSASQTQSTPTVQAAAQVTPQPQTPARPPSVATPQASQQPTPVHVQPPGTPLSQ
AAASIDNKVPTPSSVASAETNSLQPGPDVPVLEMKAEVKTEDTEPDASDARGEPGSAMME
EDLQGCSQVKEETDTVEQKSEPMEVEEKKPEVKAEAKEEEESSTNGTASQSASPSQPRKK
IFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLD
TGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYCCGRK
YEFSPQTLCCYGKQLCTIPRDAAYYSYQNRYHFCEKCFTEIQGENVTLGDDPSQPQTTIS
KDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGRTRKENK
FSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKSRFVDSG
EMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRRVYISYLDSIHFFRPR
CLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWY
KKMLDKAFAERIIHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEER
KKEESTAAGETPEGSQGDSKNAKKKNNKKTNKNKSSISRANKKKPSMPNVSNDFNTLHPI
VDPDPLLSCDLMDGRDAFLTLARDKHWEFSSLRRSKWSTLCMLVELHTQGQDRFVYTCNE
CKHHVETRWHCTVCEDYDLCINCYNTKSHTHKMVKWGLGLDDEGSSQGEPQSKSPQESRR
LSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYH
AKHCQENKCPVPFCLNIKHKLRQQQIQHRLQQAQLMRRRMATMNTRNVPQQSLPSPTSAP
PGTPTQQPSTPQTPQPPAQPQPSPVSMSPAGFPSAARTQPPTTASAGKPAGQVPAPPPPT
QPPPAAVEAARQIEREAQQQQHLYRVNIGGGMAPGRTGMVAPGTQMAPVSLSVPRPGQVG
APVVPSLPPGQWQQAPVPQQQPMPGMPRPVMSMQAQPAVAGPRMPSVQPARSISPGALQD
LLRTLKSPSSPQQQQQVLNILKSNPQLMAAFIKQRTAKYVASQPGLQPQPALQPQPGLHQ
QPGLQNLSAMQAGGPRAGVPPQQQAMGGLNAQGQALNIMSPGHNPSMASMNPQYREMLRR
QLLQQQQQPPPPGGAGMAGGMAGGMAGHSQFQQPQGPGGYAPAMQQPRVQHLPMQGGSVG
QMAAPLGQLGQMGQPGLGTDSTPSIQQALQQRLLQQQQMKQQLGSPGQPNPMSPQQHMLS
GQPQAAHLPGQQMATSLSSQVRSPAPVQSPRPQSQPPHSSPSPRIQPQPSPHHVSPQTGS
PHPGLAVTMASSIDQGHLGNPEQSAMLPQLNTPNRSALSSELSLVGDTTGDTLEKFVEGL
NT seq 6303 nt   +upstreamnt  +downstreamnt
atgggacagaacntcattgccctgctgtcatactgtaggagacagcctaacggagacagc
ctaacgtctcagatgcaaacgtcagtgggaattgtacccacacaagcaattgcaacgggc
cccactgcagatcctgaaaaacgcaaactgatacagcagcagctggttctactgcttcac
gcccataaatgtcagagacgagaacaagcaaatggagaggttcgggcctgctcgctccca
cactgtcgaaccatgaaaaatgttttgaatcacatgacacattgtcaggctgggaaagcc
tgtcaagttgcccattgtgcatcttcacgacaaatcatctctcattggaagaactgcaca
cgacatgactgtcctgtttgcctccctttgaaaaatgccagtgacaagcgaaaccaacaa
accatcctggggtctccagctagtggaattcaaaacacacttggctctgttggcgcaggc
cagcaaaatgctacttctttgagtaacccgaaccccatagaccccagctccatgcagcga
gcctacgctgctcttgggctcccctacctgaaccagccccaaacgcagctgcagcctcag
gttccgggccagcaaccagcacagcctcaaactcaccagcagatgaggactctcaacccc
ctgggaaataacccaataaacattccagcaggaggaataacagcagatcagcagccgcca
aacttgatttcagaatcagctcttccaacttccctcggggccacaaaccccctgatgaat
gacagcgccagctcggggagcatcggcgccctcagcaccataccaacagccgcccctcct
tccagcactggcgtccggaagagctggcacgaacacgtcactcaggacctgcggagccat
ctagtgcacaaacttgtccaagccatcttcccaacacctgaccctgcagccctgaaggac
cgccgcatggagaacctggtggcctatgctaagaaagtggaaggggacatgtatgagtct
gccaacagcagggatgaatactatcacttattagcagagaaaatctacaagatacagaaa
gaactagaagaaaaacggagatcacgtttacacaaacaaggcatcttgggtaaccagcca
gccttaccgacccctgcgacacagcctcccgggattccacaggcacaaactgtgagacct
ccaaatgggcccatgcccctgccagtgaatcgcatgcaggtttctcaagggatgaattca
tttaccccaatgtccttggggaatgtacagttgccacaagctcctatgggcccgcgcgca
gcgtcccctatgaaccactctgtcccgatgagcagcatgggctccgtcccagggatggcc
gtttctccttcccgggtgcctcagcctccaaacatgatgggtgcgcacgccggtaacatg
atggcccaggcgcctgcacagagccagttcctgccgcagagccagttcccgtcctccggc
ggggcgatgagtgtgaacagtgtgggcatggggcagccggcggcccagacaggcgtgtca
cagggtcaggtgcctggtgccgctcttcctaacgctctgaacatgcttgggccccaggcc
agccagctgccttgcccaccagtgacccagtctccactgcaccagacgccaccccccgcc
cctgccaccgtggccatgccggctctccagcaccctccagcgcctgggatgactcctccc
cagcccgcagctcccacccagccgtcaactcctgtgtcgtcttctgggcagactcccacc
ccgacccccggttcggtgcccagtgctagccaaacccagagcacccctactgtgcaggcg
gcggcccaggtgacaccgcagccacagaccccagcccggcccccgtctgtggccacccct
caggcatcgcagcagcccacgcccgtgcacgtccagccccccggcacaccgctttcccag
gcagctgccagcattgataacaaggtccccactccatcttcagtggccagcgctgaaacc
aactccctccagccaggacctgatgtgccagtgctggaaatgaaggctgaggtcaagacc
gaggacaccgagcctgatgccagtgatgccaggggggagcctgggtctgcgatgatggaa
gaggatttgcaaggatgttctcaagttaaagaggaaacagacacagtagagcagaaatca
gaaccgatggaagtggaggaaaagaaacctgaagtgaaagcagaagctaaagaagaagag
gagagcagtacaaatgggactgcctctcagtcagcatctccctcccagccacgcaaaaaa
atctttaagccggaggagttacgccaggctcttatgccaaccctggaagcgctgtaccgc
caggatccagagtccttgcctttccggcagccagtagatccccagctcctaggaattcca
gattattttgacatcgtgaagaatcccatggacctttccaccatcaagcggaagctggat
acagggcagtaccaagagccctggcagtatgtggacgatgtctggctcatgttcaacaac
gcctggctgtacaatcgtaaaacgtcccgggtctataagttttgcagtaaactcgcagag
gtctttgagcaagagattgaccctgtcatgcagtcccttggatattgctgtggacgcaag
tatgagttttccccccagactttgtgctgctacgggaagcagctgtgtacaattcctcgc
gatgccgcctactacagctaccagaataggtatcacttctgtgagaagtgtttcacagag
atccagggggagaatgtcaccctgggtgacgacccttcacagccccagacgacaatttca
aaggatcagtttgaaaagaagaaaaatgataccttagatcctgaaccttttgtggactgc
aaggagtgtggccggaagatgcatcagatttgtgtgctccactatgatatcatctggcct
tccggctttgtgtgcgacaactgcttgaagaaaactggcagaactcgaaaagaaaacaaa
ttcagtgctaagaggctgcagaccacacgactgggaaatcatttggaagaccgagtcaac
aagtttttgcggcggcagaatcatcctgaagccggggaggtcttcgtccgagtggtggcc
agctcagacaagactgtggaggtcaagcccgggatgaagtcacggtttgtggattctggg
gaaatgtctgaatctttcccgtatcgaaccaaagcactttttgcttttgaggaaattgat
ggagtggatgtgtgcttcttcgggatgcacgtccaggagtacggctctgactgtccccct
ccaaacacaaggcgtgtgtacatatcttatctggacagtattcatttcttccggccccga
tgcctccggacagctgtttaccatgagatccttattggatatttagaatatgtgaagaaa
ttggggtatgtaacgggacacatctgggcctgtcccccaagtgagggtgatgactacatc
ttccattgccacccccctgatcaaaaaatcccgaaaccaaagcgcctgcaggagtggtac
aagaagatgctggacaaggcatttgcggagcgcatcatccacgactacaaggacattttc
aaacaggcaactgaagacaggctcaccagtgccaaggagctgccctattttgagggtgac
ttctggcccaatgtgctggaggagagcatcaaggagctggagcaggaggaggaggagcgg
aagaaggaggagagcactgcggccggcgagacccccgagggcagccagggcgacagcaag
aatgccaagaaaaagaacaacaagaaaaccaacaagaacaaaagcagtatcagccgagcc
aacaagaagaaacccagcatgcccaacgtgtccaacgacttcaacacgctgcaccccatc
gtcgaccctgaccctctgctcagctgcgacctcatggatgggcgggacgccttcctcaca
cttgcccgagacaagcactgggaattctcatccttgcgccggtccaagtggtccacactg
tgcatgctggtggagctgcacacccagggccaggaccgctttgtctacacctgcaatgag
tgtaaacaccacgtggagacgcgctggcactgcaccgtgtgcgaggattacgacctttgc
atcaactgctacaatacgaagagccacacccacaagatggtgaagtgggggctgggcctg
gacgacgagggcagcagccagggggagccacagtccaagagtccccaggagtcgaggcgc
ctgagcatccagcgctgcatccagtcgctggtgcatgcctgccagtgccgcaatgccaac
tgctcgctgccgtcctgccaaaagatgaagcgggttgtgcagcacaccaagggctgcaag
cgcaagaccaatgggggctgcccagtgtgcaagcagctcatcgccctgtgctgctaccac
gccaagcactgccaggagaacaagtgccctgtccccttctgcctcaacatcaaacacaag
ctccgccagcagcagatccagcaccgcctgcagcaggcccagctcatgcgccggcggatg
gccaccatgaacacccgcaacgtgcctcagcagagcctgccctcccctacctcagcaccg
cccgggacccccacacagcagcccagtacgccccagacaccacagccccccgcccagccc
cagccctcacccgtgagcatgtcgccggctggcttccctagcgcggcccgaactcagccc
cccaccacggcatccgccgggaagcctgccggccaggtgccggcgccaccaccccctacc
cagccgccccccgcagctgtggaagctgcgcggcagatagagcgtgaagcccaacagcag
cagcatctgtaccgggtgaacatcggtggcggtatggcccctgggcgcacgggcatggtg
gccccgggcacccagatggcccccgtgagcctcagtgtgccacggccaggccaggttggg
gcgcccgtggtccccagcctgccgcctggccagtggcagcaggcacccgttccccagcag
cagccgatgcccggcatgcctaggcccgtgatgtccatgcaggcccagccggccgtggcc
gggccacggatgcccagcgtgcagcctgcacgcagcatctcgcctggcgccctgcaggac
ctgctgcggaccctgaagtcgcccagctccccacagcagcagcagcaggtgctcaacatc
ctcaagtcgaatccccagctgatggccgcgttcatcaagcagcgcacggccaagtacgtg
gccagccagcctggcttgcagccccagccggccctgcagccccagcctggcctgcaccag
cagccgggcctgcaaaacctgagtgccatgcaggctggtgggccgcgggccggtgttcct
cctcagcagcaggccatggggggcctgaacgcccagggccaggctctgaacatcatgagc
ccggggcacaaccccagcatggcgagcatgaatccgcagtacagggagatgctgcggagg
cagctgctccagcaacagcagcagccgccgccacccgggggtgcgggcatggcaggcggc
atggcggggggcatggccggccacagccaattccagcagccacaaggaccgggcggctac
gcccctgccatgcagcagccacgcgtgcagcacctgcctatgcagggcggctctgtgggc
cagatggcagctccgctggggcagctcggccagatggggcagcctgggctgggcacggac
agcacccccagcatccaacaggccctgcagcagcggctccttcagcagcagcagatgaag
cagcagctggggtccccgggccagccgaaccccatgagcccccagcagcacatgctctca
ggacagcctcaggccgcgcacctccctggccagcagatggccacgtccctcagcagccag
gtccggtctccggccccagtccagtccccgcggccccagtcccagcctccacattccagc
ccatcgccacggatacagccccagccttcgcctcaccacgtctccccccagactggctcc
ccccacccgggactcgcagtcaccatggccagctccatagatcagggacacttggggaac
cccgaacagagtgcgatgctcccacagctgaacacccccaacaggagtgcgttgtccagt
gagctgtccctggtcggcgacaccacaggagacaccctagagaagttcgtggagggtttg
tag

DBGET integrated database retrieval system