KEGG   Manis javanica (Malayan pangolin): 108394490
Entry
108394490         CDS       T06054                                 

Gene name
MDM2
Definition
(RefSeq) E3 ubiquitin-protein ligase Mdm2 isoform X1
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01522  Endocrine resistance
mjv01524  Platinum drug resistance
mjv04068  FoxO signaling pathway
mjv04110  Cell cycle
mjv04115  p53 signaling pathway
mjv04120  Ubiquitin mediated proteolysis
mjv04144  Endocytosis
mjv04151  PI3K-Akt signaling pathway
mjv04218  Cellular senescence
mjv04625  C-type lectin receptor signaling pathway
mjv04919  Thyroid hormone signaling pathway
mjv05163  Human cytomegalovirus infection
mjv05165  Human papillomavirus infection
mjv05169  Epstein-Barr virus infection
mjv05200  Pathways in cancer
mjv05202  Transcriptional misregulation in cancer
mjv05203  Viral carcinogenesis
mjv05205  Proteoglycans in cancer
mjv05206  MicroRNAs in cancer
mjv05214  Glioma
mjv05215  Prostate cancer
mjv05218  Melanoma
mjv05219  Bladder cancer
mjv05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    108394490 (MDM2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    108394490 (MDM2)
   04151 PI3K-Akt signaling pathway
    108394490 (MDM2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    108394490 (MDM2)
  09143 Cell growth and death
   04110 Cell cycle
    108394490 (MDM2)
   04115 p53 signaling pathway
    108394490 (MDM2)
   04218 Cellular senescence
    108394490 (MDM2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    108394490 (MDM2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    108394490 (MDM2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108394490 (MDM2)
   05202 Transcriptional misregulation in cancer
    108394490 (MDM2)
   05206 MicroRNAs in cancer
    108394490 (MDM2)
   05205 Proteoglycans in cancer
    108394490 (MDM2)
   05203 Viral carcinogenesis
    108394490 (MDM2)
  09162 Cancer: specific types
   05214 Glioma
    108394490 (MDM2)
   05220 Chronic myeloid leukemia
    108394490 (MDM2)
   05218 Melanoma
    108394490 (MDM2)
   05219 Bladder cancer
    108394490 (MDM2)
   05215 Prostate cancer
    108394490 (MDM2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    108394490 (MDM2)
   05169 Epstein-Barr virus infection
    108394490 (MDM2)
   05165 Human papillomavirus infection
    108394490 (MDM2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108394490 (MDM2)
   01522 Endocrine resistance
    108394490 (MDM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mjv04131]
    108394490 (MDM2)
   04121 Ubiquitin system [BR:mjv04121]
    108394490 (MDM2)
Enzymes [BR:mjv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     108394490 (MDM2)
Membrane trafficking [BR:mjv04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    108394490 (MDM2)
Ubiquitin system [BR:mjv04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    108394490 (MDM2)
SSDB
Motif
Pfam: zf-C3HC4_3 SWIB zf-RanBP zf-RING_2 zf-FPG_IleRS
Other DBs
NCBI-GeneID: 108394490
NCBI-ProteinID: XP_017511562
LinkDB
Position
Unknown
AA seq 491 aa
MCNTNMSVSTDGAVSTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVIFYLGQY
IMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQESSDSGT
SVSENRCHLEGGSDEKDPVQELQEEKPSSSDLVSRPSTSSRRRAISETEECSDELPGERQ
RKRHKSDSISLSFDESLALCVIREICCERSSGSESTGTPSNSDLDAGVSEHSGDWLDQDS
VSDQFSVEFEVESLDSEDYSLSEDGQELSDEDDEVYRVTVYQAGESDTDSFEEDPEISLA
DYWKCTSCSEMNPPLPPHCNRCWALRENWLPEDKGRDKGKKPEKAKLESSAQAEEGFDVP
DCKKNTVNESREPCVEENDDKITQTSQSQESEDYSQPSTSNSVIYSSQEDVKEFEREDTQ
DKEESVESSFPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQ
PIQMIVLTYFP
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgtgcaataccaacatgtctgtgtctactgatggtgctgtaagcacctcacagattcca
gcttcggaacaagagaccctggttaggccaaagccattgcttttgaagttgctaaagtct
gttggtgcacaaaaagacacttatactatgaaagaggttatattttatcttggccagtat
attatgactaaacgattatatgatgagaaacaacagcatattgtatattgttcgaatgat
cttctaggggatttgtttggagtgccaagcttctctgtgaaagagcacaggaaaatatat
acaatgatctacagaaacttggtagtagtcaatcagcaggaatcatcagattcaggcaca
tctgtgagtgaaaacaggtgtcacctcgaaggtgggagtgatgaaaaggaccctgtgcaa
gagctacaggaagagaaaccttcatcttcagatttggtttctagaccatctacctcatct
agaaggagagcaattagtgagacagaagaatgttcagatgaattacctggtgaacgacaa
agaaagcgccacaaatctgatagtatatccctttcctttgatgagagccttgctctgtgt
gtcataagggagatatgttgtgaaagaagcagtggcagtgagtcaacagggactccgtca
aactcggatcttgatgctggtgtaagtgaacattcaggtgattggttggatcaggattca
gtttcagatcagttcagtgtagaatttgaagttgagtctcttgattcagaagattatagc
cttagtgaagatggacaagaactctcagacgaagatgatgaggtatatcgagttactgtg
tatcaggcaggagagagtgatacagattcatttgaagaagatcctgaaatttccttagct
gactattggaagtgtacttcgtgcagtgaaatgaatcctcccctgccaccacattgcaac
agatgttgggcccttcgtgagaattggcttcctgaagacaaaggcagagacaaagggaaa
aagcctgagaaagccaaactagaaagctcagcacaagcagaagagggctttgatgtccct
gattgtaaaaaaaatacagtgaatgagtctagagagccatgtgttgaggaaaatgatgat
aaaatcacacaaacctcccaatcccaagaaagtgaggactattctcagccatcaacttct
aatagtgtcatttatagcagccaagaagatgtcaaagagtttgagagggaagacacacaa
gacaaagaagaaagtgtggaatctagttttcctcttaatgccattgaaccttgtgtgatt
tgccaaggtcgacctaaaaatgggtgcattgttcatggcaaaacgggacatcttatggca
tgtttcacatgtgcaaagaagctaaagaagagaaataagccctgtccagtatgtaggcaa
ccaattcaaatgattgtgctaacttattttccctag

DBGET integrated database retrieval system