KEGG   Manis javanica (Malayan pangolin): 108394537
Entry
108394537         CDS       T06054                                 

Gene name
AIM2
Definition
(RefSeq) interferon-inducible protein AIM2
  KO
K12966  absent in melanoma 2
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04621  NOD-like receptor signaling pathway
mjv04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    108394537 (AIM2)
   04623 Cytosolic DNA-sensing pathway
    108394537 (AIM2)
SSDB
Motif
Pfam: HIN PYRIN DED DUF1264 tRNA_anti-codon Hc1
Other DBs
NCBI-GeneID: 108394537
NCBI-ProteinID: XP_017511635
LinkDB
Position
Unknown
AA seq 346 aa
MESKYREILLLIGLDNITDEELDRFKFFLPDEFEVSAGKLENASRTELANLMIQNVGVAS
AMQKTIRIFQKLNYRHVAKCLQEEKEKVDKKCKMEKGTKLVKKNQAAVNPGVSAAPRKDV
EHQHVAPKASLPVQPKQKHTVAQQASIRKEGLQRNPMTVMVLKAMKPFEFEAQEGKQEMF
HATVATDSQFFFVKVFNPELKDKFTPKKVILISKYYWHTHFLEVNRASLVFDAASDQQVS
VPKTVIRKAGETPKISKLQTQPLGTIVNGLFVVQKTTEQKNRILFDLSDNTGRMEVLVFG
KQNEIKCEEGDKLRLTFFELSRTGEKLQLKSGAHSVIKVIKARNLK
NT seq 1041 nt   +upstreamnt  +downstreamnt
atggaaagtaaatacagagaaatcctgttgttaatcggcctggataacatcactgatgag
gaactggacagatttaagttctttcttccagatgagtttgaggtttccgcaggtaaacta
gaaaatgcaagcaggacggagttagctaacttgatgatccaaaacgttggtgtcgcctct
gccatgcagaagaccatacggattttccagaagttgaattataggcatgtggccaaatgc
cttcaggaagagaaggaaaaagttgataagaaatgcaaaatggaaaaaggaacaaagcta
gtgaaaaagaatcaagctgcagtgaatcctggggtctctgcagcccccagaaaggacgtt
gagcaccaacatgttgcacccaaggcctcgcttcctgttcagcctaagcagaaacacaca
gtggcccagcaagcttctatcagaaaagaagggttgcagagaaaccctatgacagtcatg
gtgctgaaggcaatgaagccatttgaatttgaggcccaggaagggaaacaagagatgttc
catgctacagtggctaccgacagtcaattcttttttgtaaaagttttcaatccagagctc
aaagataaattcactccaaagaaagtaattctaatatcaaaatattattggcacactcat
ttcctggaagtgaaccgtgcctccctggtgtttgatgctgcatctgaccagcaggtcagt
gtcccaaagaccgttatcagaaaagctggtgaaaccccaaagatcagtaagcttcaaact
cagccccttgggacaattgtgaatgggctgtttgtagttcagaagacaacggaacagaag
aatcgcatattatttgacctcagtgacaacacagggaggatggaagtattggtgtttgga
aaacagaacgaaatcaaatgtgaggaaggggataaacttcgacttacgttctttgagctg
tcaagaactggagaaaaactacagctgaagtctggagcacacagcgtcattaaggttatt
aaggccagaaatttgaagtga

DBGET integrated database retrieval system