KEGG   Manis javanica (Malayan pangolin): 108394617
Entry
108394617         CDS       T06054                                 

Gene name
BRCA1
Definition
(RefSeq) LOW QUALITY PROTEIN: breast cancer type 1 susceptibility protein
  KO
K10605  breast cancer type 1 susceptibility protein [EC:2.3.2.27]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01524  Platinum drug resistance
mjv03440  Homologous recombination
mjv03460  Fanconi anemia pathway
mjv04120  Ubiquitin mediated proteolysis
mjv04151  PI3K-Akt signaling pathway
mjv05206  MicroRNAs in cancer
mjv05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    108394617 (BRCA1)
  09124 Replication and repair
   03440 Homologous recombination
    108394617 (BRCA1)
   03460 Fanconi anemia pathway
    108394617 (BRCA1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    108394617 (BRCA1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    108394617 (BRCA1)
  09162 Cancer: specific types
   05224 Breast cancer
    108394617 (BRCA1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108394617 (BRCA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mjv01009]
    108394617 (BRCA1)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mjv04121]
    108394617 (BRCA1)
   03036 Chromosome and associated proteins [BR:mjv03036]
    108394617 (BRCA1)
   03400 DNA repair and recombination proteins [BR:mjv03400]
    108394617 (BRCA1)
Enzymes [BR:mjv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     108394617 (BRCA1)
Protein phosphatases and associated proteins [BR:mjv01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     108394617 (BRCA1)
Ubiquitin system [BR:mjv04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    108394617 (BRCA1)
  Multi subunit Ring-finger type E3
   BRCC complex
    108394617 (BRCA1)
Chromosome and associated proteins [BR:mjv03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     108394617 (BRCA1)
DNA repair and recombination proteins [BR:mjv03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA1-core complex
     108394617 (BRCA1)
    BRCA1-A complex
     108394617 (BRCA1)
    BRCA1-B complex
     108394617 (BRCA1)
    BRCA1-C complex
     108394617 (BRCA1)
    BRCA complex
     108394617 (BRCA1)
   FA (Fanconi anemia) pathway
    Downstream FA components
     108394617 (BRCA1)
SSDB
Motif
Pfam: BRCT zf-C3HC4 zf-C3HC4_2 zf-C3HC4_4 zf-C3HC4_3 zf-RING_2 zf-RING_UBOX zf-Nse zf-RING_5 BRCT_2 zf-RING_6 zf-ANAPC11 Prok-RING_4 zf-RING_10 zf-rbx1 RTT107_BRCT_5 Baculo_IE-1 zf-RING_4
Other DBs
NCBI-GeneID: 108394617
NCBI-ProteinID: XP_017511774
LinkDB
Position
Unknown
AA seq 778 aa
MDLSADRVEEVQNVLNAMQKVLECPICLELIKEPVSTKCDHIFCKFCMLKLLNQKKGPSQ
CPLCKNNITKRSLQESTRFSQLVEELLKIIHAFELDTGLEFTNSYNFSKKENNSPEHLKE
EVSIIQSMGYRNRARRLRQNEPENPTLQETSLSIQLSDLGIVRSLRTKQQIQPKNKSVYI
ELGSDSSEETVNKADCCSVGDHELLQITPQSARAEASVNPGKKAACGCSEKDIANLEPHQ
SSNKDLTTAKKHSTEQHPEKYQGEAAYGYESETSLSEAYSVQSSQSGILTTQQRDTMQDN
LIKLQQEMAELEAVLEQHSSQPSNSPPFLIADSCAPEDQLNLEQNTSEKVLTSEKSSEYP
IRQNSKSLSADKFQVPLDSSTSKNKEPEMERSSPSKLPLLDNRWYMHSHSSLQNGNCPSQ
KELSKVVDMEEQQLSKFEAQDLMEQPYLSRQDPEGSPYLESGISLFSDDPESDPSEDRAP
ELAHVCSKTTSTSALKLPQFQVEESAKSPATAHTINTARYTVREESMNREKPEVLSSTKR
VSNRMSVVASGLTPKEFMLVQKFARKHHINLTDLVTEETTHVIMKTDAEFVCERTLKYFL
GIAGGKWVVSYFWVTQCIKERKVLDEHDFEVRGDVVNGRNHQGPKRARESQDREIFRGLE
ICCYGPFTNMPTDRLEWMVHLCGASVVKEPSSFTFGKGTHPVVVVQPDAWTEDSGFQLIG
QVCEASVVTREWVLDSVALYQCQELDTYLIPQIPRRAAADSSQPRVSCVGPVFIGPQE
NT seq 2337 nt   +upstreamnt  +downstreamnt
atggatttatctgcggatcgggttgaagaagtacaaaatgtcctcaatgctatgcagaaa
gtcttagagtgtccaatctgtctagaattgatcaaagagcctgtttccacaaagtgtgac
cacatattttgcaaattttgtatgctgaaacttctcaaccagaagaaaggaccttcacaa
tgtcctttgtgtaagaataatataaccaaaagaagcctacaggaaagcacaagatttagt
caacttgttgaagagctattgaaaatcattcatgcttttgaacttgacacaggattagag
tttacaaacagttacaacttttcaaaaaaggaaaataactctcctgagcatttaaaggag
gaagtttctatcatccagagtatgggctaccgaaaccgtgccagaagacttcgacagaat
gaacctgaaaatcctaccttgcaggaaaccagtcttagtatccaactctctgaccttgga
attgtgagatctctgagaacaaaacagcagatacaacctaagaataagtctgtctacatt
gaattgggatctgattcttctgaagaaacagtaaataaggcagattgttgcagtgtggga
gatcatgaactgttacaaattacccctcaaagtgccagggctgaagccagtgtgaatcct
ggaaaaaaggctgcttgtgggtgttctgaaaaggacatagcaaatcttgaacctcatcag
tccagtaataaagatttgaccactgctaagaagcattcaactgagcagcatccagaaaag
tatcagggtgaagcagcatacgggtacgagagtgaaacaagcctctctgaagcctattca
gtgcagtcctctcagagcggaattttaaccactcagcagagggataccatgcaagataac
ctcataaagctccaacaggaaatggccgaactggaagctgtgttagagcagcacagcagc
caaccttctaacagcccccctttcctcatagctgattcttgtgcccctgaggaccagcta
aatctggaacaaaacacatcagaaaaagtattaacttcagagaaaagtagtgaataccct
ataaggcagaattcaaagagcctttctgctgacaagtttcaagtacctctggatagttcc
accagtaaaaataaagaaccagaaatggaaaggtcttccccttctaaactcccattgcta
gataataggtggtatatgcacagccactcgagtcttcagaatggaaattgcccatctcaa
aaggagctcagcaaggttgttgatatggaggagcaacagctgtctaagtttgaggcccag
gatttaatggagcagccttacttgtcaagacaagacccagagggaagcccttacctagaa
tctggaatcagcctcttctctgatgaccctgagtctgatccctctgaagacagagcccca
gagctggctcatgtttgcagcaagacaacttcaacctcagcattgaaattaccccaattt
caagttgaagaatctgccaaaagtccagctaccgctcatactattaatactgctaggtat
actgtgagggaagaaagtatgaacagggaaaagccagaagtgttatcttcaacaaaaaga
gtcagcaacagaatgtctgtggtagcatcaggcttgaccccaaaagaatttatgcttgtg
caaaagtttgccagaaaacaccacatcaatttaactgatctagttactgaagagactact
catgtcattatgaaaacagatgctgagtttgtgtgtgaacggacactgaaatattttctg
ggaattgcaggaggaaaatgggtagttagctatttctgggtgacccagtgtattaaagaa
agaaaggtgctagatgagcatgattttgaagtcagaggagatgttgtcaatggaagaaac
caccaaggcccaaagcgagcaagagaatcccaggacagagagatcttcagaggcctagaa
atctgttgctatgggccctttaccaacatgcctacagatcggctagagtggatggtgcat
ctatgtggagcttctgtggtgaaggagccttcatcattcacctttggcaagggcactcac
ccagttgtggttgtgcaaccggatgcctggacagaggacagtggcttccaattgattggg
caggtgtgtgaggcatctgtggtgacacgagagtgggtactggacagcgtagccctctac
caatgccaggagctggacacctacctgataccccagatccccagaagagctgctgctgat
tccagccagccgcgtgtgtcatgtgtagggcctgtcttcataggaccccaagaatga

DBGET integrated database retrieval system