Manis javanica (Malayan pangolin): 108394635 Help Entry 108394635         CDS       T06054                                  Definition (RefSeq) mitogen-activated protein kinase 13   KO K04441   p38 MAP kinase [EC:2.7.11.24] Organism mjv  Manis javanica (Malayan pangolin) Pathway mjv01522   Endocrine resistance mjv04010   MAPK signaling pathway mjv04015   Rap1 signaling pathway mjv04068   FoxO signaling pathway mjv04071   Sphingolipid signaling pathway mjv04114   Oocyte meiosis mjv04218   Cellular senescence mjv04261   Adrenergic signaling in cardiomyocytes mjv04370   VEGF signaling pathway mjv04380   Osteoclast differentiation mjv04550   Signaling pathways regulating pluripotency of stem cells mjv04611   Platelet activation mjv04613   Neutrophil extracellular trap formation mjv04620   Toll-like receptor signaling pathway mjv04621   NOD-like receptor signaling pathway mjv04622   RIG-I-like receptor signaling pathway mjv04625   C-type lectin receptor signaling pathway mjv04657   IL-17 signaling pathway mjv04658   Th1 and Th2 cell differentiation mjv04659   Th17 cell differentiation mjv04660   T cell receptor signaling pathway mjv04664   Fc epsilon RI signaling pathway mjv04668   TNF signaling pathway mjv04670   Leukocyte transendothelial migration mjv04714   Thermogenesis mjv04722   Neurotrophin signaling pathway mjv04723   Retrograde endocannabinoid signaling mjv04728   Dopaminergic synapse mjv04750   Inflammatory mediator regulation of TRP channels mjv04912   GnRH signaling pathway mjv04914   Progesterone-mediated oocyte maturation mjv04917   Prolactin signaling pathway mjv04926   Relaxin signaling pathway mjv04933   AGE-RAGE signaling pathway in diabetic complications mjv04935   Growth hormone synthesis, secretion and action mjv05014   Amyotrophic lateral sclerosis mjv05020   Prion disease mjv05022   Pathways of neurodegeneration - multiple diseases mjv05132   Salmonella infection mjv05133   Pertussis mjv05135   Yersinia infection mjv05140   Leishmaniasis mjv05142   Chagas disease mjv05145   Toxoplasmosis mjv05152   Tuberculosis mjv05161   Hepatitis B mjv05163   Human cytomegalovirus infection mjv05167   Kaposi sarcoma-associated herpesvirus infection mjv05169   Epstein-Barr virus infection mjv05170   Human immunodeficiency virus 1 infection mjv05171   Coronavirus disease - COVID-19 mjv05205   Proteoglycans in cancer mjv05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mjv05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mjv00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     108394635    04015 Rap1 signaling pathway     108394635    04370 VEGF signaling pathway     108394635    04668 TNF signaling pathway     108394635    04068 FoxO signaling pathway     108394635    04071 Sphingolipid signaling pathway     108394635  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     108394635    04218 Cellular senescence     108394635   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     108394635  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     108394635    04613 Neutrophil extracellular trap formation     108394635    04620 Toll-like receptor signaling pathway     108394635    04621 NOD-like receptor signaling pathway     108394635    04622 RIG-I-like receptor signaling pathway     108394635    04625 C-type lectin receptor signaling pathway     108394635    04660 T cell receptor signaling pathway     108394635    04658 Th1 and Th2 cell differentiation     108394635    04659 Th17 cell differentiation     108394635    04657 IL-17 signaling pathway     108394635    04664 Fc epsilon RI signaling pathway     108394635    04670 Leukocyte transendothelial migration     108394635   09152 Endocrine system    04912 GnRH signaling pathway     108394635    04914 Progesterone-mediated oocyte maturation     108394635    04917 Prolactin signaling pathway     108394635    04926 Relaxin signaling pathway     108394635    04935 Growth hormone synthesis, secretion and action     108394635   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     108394635   09156 Nervous system    04728 Dopaminergic synapse     108394635    04723 Retrograde endocannabinoid signaling     108394635    04722 Neurotrophin signaling pathway     108394635   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     108394635   09158 Development and regeneration    04380 Osteoclast differentiation     108394635   09159 Environmental adaptation    04714 Thermogenesis     108394635  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     108394635    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     108394635   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     108394635    05020 Prion disease     108394635    05022 Pathways of neurodegeneration - multiple diseases     108394635   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     108394635   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     108394635   09171 Infectious disease: bacterial    05132 Salmonella infection     108394635    05135 Yersinia infection     108394635    05133 Pertussis     108394635    05152 Tuberculosis     108394635   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     108394635    05161 Hepatitis B     108394635    05171 Coronavirus disease - COVID-19     108394635    05163 Human cytomegalovirus infection     108394635    05167 Kaposi sarcoma-associated herpesvirus infection     108394635    05169 Epstein-Barr virus infection     108394635   09174 Infectious disease: parasitic    05145 Toxoplasmosis     108394635    05140 Leishmaniasis     108394635    05142 Chagas disease     108394635   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     108394635  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:mjv01001]     108394635 Enzymes [BR:mjv01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      108394635 Protein kinases [BR:mjv01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    108394635 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like Motif Other DBs NCBI-GeneID:  108394635 NCBI-ProteinID:  XP_017511791 LinkDB All DBs Position Unknown AA seq 366 aa AA seqDB search MNLTRKKGFYKQDVNRTAWELPKTYVSPTHLGSGAYGSVCSAIDKRSGEKVAIKKLSRPF QSEIFAKRAYRELLLLKHMQHENVIGLLDVFTSASSLRSFHDFYLVMPFMQTDLQKIMGM EFSEDKIQYLVYQMLKGLKYIHSAGVIHRDLKPGNLAVNEDCELKILDFGLARPADAEMT GYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTG VPGAEFVQKLKDKAAKSYIQALPQSPKKDFSQLFPQASSQAIDLLEKMLELDVDKRLTAS QALTHPFFEPFRDPEEETEVQQPFDDSLEHEKFTVDEWKQHIYKEIVNFRPIARKDSRRR SGMKLQ NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt atgaacctcacccggaaaaaaggcttctacaagcaggacgtcaacaggaccgcctgggag ctgcccaagacctacgtgtccccgacgcacttgggcagcggggcctacggctccgtgtgc tcagccatcgacaagcggtcaggggagaaggtggccatcaagaagctgagccggcccttc cagtccgagatctttgccaagcgggcctaccgggagctgctcctgctgaaacacatgcag catgagaatgttatcgggctcctggatgtcttcacctcagcctcctccctgcgcagcttc catgacttctacctggtaatgcccttcatgcagacggacctgcagaagatcatggggatg gagttcagcgaggacaagatccagtacctggtgtatcagatgctcaagggtcttaagtac atccactcagctggcgtcatccacagggacctgaagccgggcaaccttgctgtgaacgag gactgtgagctgaagatcttggattttgggctggcaaggcctgcagacgcagagatgacg ggctatgtggtgacccgctggtaccgggcccccgaggtgatcctcagctggatgcactat aaccagactgtggacatctggtctgtgggctgtatcatggcagagatgctgacaggaaaa actctgttcaaagggaaagattacctcgaccagctgacccagatcctgaaggtgactggg gtgccgggtgcagagtttgtgcagaagttgaaggacaaagcggccaaatcctatatccag gccctgccacagagccctaagaaggatttctctcagctcttcccacaagccagctcccag gccatagatctgctagagaagatgctggagctggatgtggacaagcgcctgacagcctcg caggccctcacccaccccttctttgaacccttccgggacccggaggaggagacggaggtt cagcagccatttgatgattccttagaacatgagaaatttacagtggacgagtggaagcag cacatttacaaggagattgtgaacttcagacccattgcccggaaggactcacggcgccgg agtggcatgaagctgcagtga

Manis javanica (Malayan pangolin): 108394636 Help Entry 108394636         CDS       T06054                                  Gene name MAPK14 Definition (RefSeq) mitogen-activated protein kinase 14   KO K04441   p38 MAP kinase [EC:2.7.11.24] Organism mjv  Manis javanica (Malayan pangolin) Pathway mjv01522   Endocrine resistance mjv04010   MAPK signaling pathway mjv04015   Rap1 signaling pathway mjv04068   FoxO signaling pathway mjv04071   Sphingolipid signaling pathway mjv04114   Oocyte meiosis mjv04218   Cellular senescence mjv04261   Adrenergic signaling in cardiomyocytes mjv04370   VEGF signaling pathway mjv04380   Osteoclast differentiation mjv04550   Signaling pathways regulating pluripotency of stem cells mjv04611   Platelet activation mjv04613   Neutrophil extracellular trap formation mjv04620   Toll-like receptor signaling pathway mjv04621   NOD-like receptor signaling pathway mjv04622   RIG-I-like receptor signaling pathway mjv04625   C-type lectin receptor signaling pathway mjv04657   IL-17 signaling pathway mjv04658   Th1 and Th2 cell differentiation mjv04659   Th17 cell differentiation mjv04660   T cell receptor signaling pathway mjv04664   Fc epsilon RI signaling pathway mjv04668   TNF signaling pathway mjv04670   Leukocyte transendothelial migration mjv04714   Thermogenesis mjv04722   Neurotrophin signaling pathway mjv04723   Retrograde endocannabinoid signaling mjv04728   Dopaminergic synapse mjv04750   Inflammatory mediator regulation of TRP channels mjv04912   GnRH signaling pathway mjv04914   Progesterone-mediated oocyte maturation mjv04917   Prolactin signaling pathway mjv04926   Relaxin signaling pathway mjv04933   AGE-RAGE signaling pathway in diabetic complications mjv04935   Growth hormone synthesis, secretion and action mjv05014   Amyotrophic lateral sclerosis mjv05020   Prion disease mjv05022   Pathways of neurodegeneration - multiple diseases mjv05132   Salmonella infection mjv05133   Pertussis mjv05135   Yersinia infection mjv05140   Leishmaniasis mjv05142   Chagas disease mjv05145   Toxoplasmosis mjv05152   Tuberculosis mjv05161   Hepatitis B mjv05163   Human cytomegalovirus infection mjv05167   Kaposi sarcoma-associated herpesvirus infection mjv05169   Epstein-Barr virus infection mjv05170   Human immunodeficiency virus 1 infection mjv05171   Coronavirus disease - COVID-19 mjv05205   Proteoglycans in cancer mjv05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mjv05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mjv00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     108394636 (MAPK14)    04015 Rap1 signaling pathway     108394636 (MAPK14)    04370 VEGF signaling pathway     108394636 (MAPK14)    04668 TNF signaling pathway     108394636 (MAPK14)    04068 FoxO signaling pathway     108394636 (MAPK14)    04071 Sphingolipid signaling pathway     108394636 (MAPK14)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     108394636 (MAPK14)    04218 Cellular senescence     108394636 (MAPK14)   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     108394636 (MAPK14)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     108394636 (MAPK14)    04613 Neutrophil extracellular trap formation     108394636 (MAPK14)    04620 Toll-like receptor signaling pathway     108394636 (MAPK14)    04621 NOD-like receptor signaling pathway     108394636 (MAPK14)    04622 RIG-I-like receptor signaling pathway     108394636 (MAPK14)    04625 C-type lectin receptor signaling pathway     108394636 (MAPK14)    04660 T cell receptor signaling pathway     108394636 (MAPK14)    04658 Th1 and Th2 cell differentiation     108394636 (MAPK14)    04659 Th17 cell differentiation     108394636 (MAPK14)    04657 IL-17 signaling pathway     108394636 (MAPK14)    04664 Fc epsilon RI signaling pathway     108394636 (MAPK14)    04670 Leukocyte transendothelial migration     108394636 (MAPK14)   09152 Endocrine system    04912 GnRH signaling pathway     108394636 (MAPK14)    04914 Progesterone-mediated oocyte maturation     108394636 (MAPK14)    04917 Prolactin signaling pathway     108394636 (MAPK14)    04926 Relaxin signaling pathway     108394636 (MAPK14)    04935 Growth hormone synthesis, secretion and action     108394636 (MAPK14)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     108394636 (MAPK14)   09156 Nervous system    04728 Dopaminergic synapse     108394636 (MAPK14)    04723 Retrograde endocannabinoid signaling     108394636 (MAPK14)    04722 Neurotrophin signaling pathway     108394636 (MAPK14)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     108394636 (MAPK14)   09158 Development and regeneration    04380 Osteoclast differentiation     108394636 (MAPK14)   09159 Environmental adaptation    04714 Thermogenesis     108394636 (MAPK14)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     108394636 (MAPK14)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     108394636 (MAPK14)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     108394636 (MAPK14)    05020 Prion disease     108394636 (MAPK14)    05022 Pathways of neurodegeneration - multiple diseases     108394636 (MAPK14)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     108394636 (MAPK14)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     108394636 (MAPK14)   09171 Infectious disease: bacterial    05132 Salmonella infection     108394636 (MAPK14)    05135 Yersinia infection     108394636 (MAPK14)    05133 Pertussis     108394636 (MAPK14)    05152 Tuberculosis     108394636 (MAPK14)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     108394636 (MAPK14)    05161 Hepatitis B     108394636 (MAPK14)    05171 Coronavirus disease - COVID-19     108394636 (MAPK14)    05163 Human cytomegalovirus infection     108394636 (MAPK14)    05167 Kaposi sarcoma-associated herpesvirus infection     108394636 (MAPK14)    05169 Epstein-Barr virus infection     108394636 (MAPK14)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     108394636 (MAPK14)    05140 Leishmaniasis     108394636 (MAPK14)    05142 Chagas disease     108394636 (MAPK14)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     108394636 (MAPK14)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:mjv01001]     108394636 (MAPK14) Enzymes [BR:mjv01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      108394636 (MAPK14) Protein kinases [BR:mjv01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    108394636 (MAPK14) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr APH Kinase-like Kdo Motif Other DBs NCBI-GeneID:  108394636 NCBI-ProteinID:  XP_017511792 LinkDB All DBs Position Unknown AA seq 283 aa AA seqDB search MKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRG LKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNW MHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARN YIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITATQALAHAYFAQYHDPDDE PVADPYDQSFESRDLLIDEWKSLTYGEVISFVPPPLDQEEMES NT seq 852 nt NT seq  +upstreamnt  +downstreamnt atgaaacatgaaaatgtgattggtctgttggatgttttcacacctgcaaggtctctggag gagttcaatgatgtgtatttggtgacccatctcatgggggcagatctgaacaacattgtg aagtgtcagaagcttacagatgaccatgttcagtttcttatttaccaaattctccgaggc ctcaagtatatacattcagctgacataattcacagggacctaaaacctagtaatctagct gtgaatgaagactgtgagctgaagatcttggattttggactggctcgacacacagatgat gaaatgacaggctacgtggccactaggtggtacagggctcctgagatcatgctgaattgg atgcattacaaccagacagttgatatttggtcagtgggatgcataatggccgagctgttg actggaagaacattgtttcctggtacagaccatattgatcagttgaagctcattttaaga ctcgttggaaccccaggggctgagcttttgaagaaaatctcctcagagtctgcaagaaac tacattcagtctttgacccagatgccgaagatgaactttgcaaatgtatttattggtgcc aatcccttggctgtcgacttgctggagaagatgcttgtattagactcagacaagagaatc acagccacccaagcccttgcgcatgcctactttgctcagtaccacgatcctgatgatgaa ccagtggctgatccttacgatcagtcctttgaaagcagggacctccttatagatgaatgg aaaagcctgacctacggtgaagtcatcagctttgtgcccccgccccttgaccaagaagag atggaatcttga

Manis javanica (Malayan pangolin): 108395598 Help Entry 108395598         CDS       T06054                                  Gene name MAPK12 Definition (RefSeq) mitogen-activated protein kinase 12   KO K04441   p38 MAP kinase [EC:2.7.11.24] Organism mjv  Manis javanica (Malayan pangolin) Pathway mjv01522   Endocrine resistance mjv04010   MAPK signaling pathway mjv04015   Rap1 signaling pathway mjv04068   FoxO signaling pathway mjv04071   Sphingolipid signaling pathway mjv04114   Oocyte meiosis mjv04218   Cellular senescence mjv04261   Adrenergic signaling in cardiomyocytes mjv04370   VEGF signaling pathway mjv04380   Osteoclast differentiation mjv04550   Signaling pathways regulating pluripotency of stem cells mjv04611   Platelet activation mjv04613   Neutrophil extracellular trap formation mjv04620   Toll-like receptor signaling pathway mjv04621   NOD-like receptor signaling pathway mjv04622   RIG-I-like receptor signaling pathway mjv04625   C-type lectin receptor signaling pathway mjv04657   IL-17 signaling pathway mjv04658   Th1 and Th2 cell differentiation mjv04659   Th17 cell differentiation mjv04660   T cell receptor signaling pathway mjv04664   Fc epsilon RI signaling pathway mjv04668   TNF signaling pathway mjv04670   Leukocyte transendothelial migration mjv04714   Thermogenesis mjv04722   Neurotrophin signaling pathway mjv04723   Retrograde endocannabinoid signaling mjv04728   Dopaminergic synapse mjv04750   Inflammatory mediator regulation of TRP channels mjv04912   GnRH signaling pathway mjv04914   Progesterone-mediated oocyte maturation mjv04917   Prolactin signaling pathway mjv04926   Relaxin signaling pathway mjv04933   AGE-RAGE signaling pathway in diabetic complications mjv04935   Growth hormone synthesis, secretion and action mjv05014   Amyotrophic lateral sclerosis mjv05020   Prion disease mjv05022   Pathways of neurodegeneration - multiple diseases mjv05132   Salmonella infection mjv05133   Pertussis mjv05135   Yersinia infection mjv05140   Leishmaniasis mjv05142   Chagas disease mjv05145   Toxoplasmosis mjv05152   Tuberculosis mjv05161   Hepatitis B mjv05163   Human cytomegalovirus infection mjv05167   Kaposi sarcoma-associated herpesvirus infection mjv05169   Epstein-Barr virus infection mjv05170   Human immunodeficiency virus 1 infection mjv05171   Coronavirus disease - COVID-19 mjv05205   Proteoglycans in cancer mjv05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mjv05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mjv00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     108395598 (MAPK12)    04015 Rap1 signaling pathway     108395598 (MAPK12)    04370 VEGF signaling pathway     108395598 (MAPK12)    04668 TNF signaling pathway     108395598 (MAPK12)    04068 FoxO signaling pathway     108395598 (MAPK12)    04071 Sphingolipid signaling pathway     108395598 (MAPK12)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     108395598 (MAPK12)    04218 Cellular senescence     108395598 (MAPK12)   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     108395598 (MAPK12)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     108395598 (MAPK12)    04613 Neutrophil extracellular trap formation     108395598 (MAPK12)    04620 Toll-like receptor signaling pathway     108395598 (MAPK12)    04621 NOD-like receptor signaling pathway     108395598 (MAPK12)    04622 RIG-I-like receptor signaling pathway     108395598 (MAPK12)    04625 C-type lectin receptor signaling pathway     108395598 (MAPK12)    04660 T cell receptor signaling pathway     108395598 (MAPK12)    04658 Th1 and Th2 cell differentiation     108395598 (MAPK12)    04659 Th17 cell differentiation     108395598 (MAPK12)    04657 IL-17 signaling pathway     108395598 (MAPK12)    04664 Fc epsilon RI signaling pathway     108395598 (MAPK12)    04670 Leukocyte transendothelial migration     108395598 (MAPK12)   09152 Endocrine system    04912 GnRH signaling pathway     108395598 (MAPK12)    04914 Progesterone-mediated oocyte maturation     108395598 (MAPK12)    04917 Prolactin signaling pathway     108395598 (MAPK12)    04926 Relaxin signaling pathway     108395598 (MAPK12)    04935 Growth hormone synthesis, secretion and action     108395598 (MAPK12)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     108395598 (MAPK12)   09156 Nervous system    04728 Dopaminergic synapse     108395598 (MAPK12)    04723 Retrograde endocannabinoid signaling     108395598 (MAPK12)    04722 Neurotrophin signaling pathway     108395598 (MAPK12)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     108395598 (MAPK12)   09158 Development and regeneration    04380 Osteoclast differentiation     108395598 (MAPK12)   09159 Environmental adaptation    04714 Thermogenesis     108395598 (MAPK12)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     108395598 (MAPK12)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     108395598 (MAPK12)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     108395598 (MAPK12)    05020 Prion disease     108395598 (MAPK12)    05022 Pathways of neurodegeneration - multiple diseases     108395598 (MAPK12)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     108395598 (MAPK12)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     108395598 (MAPK12)   09171 Infectious disease: bacterial    05132 Salmonella infection     108395598 (MAPK12)    05135 Yersinia infection     108395598 (MAPK12)    05133 Pertussis     108395598 (MAPK12)    05152 Tuberculosis     108395598 (MAPK12)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     108395598 (MAPK12)    05161 Hepatitis B     108395598 (MAPK12)    05171 Coronavirus disease - COVID-19     108395598 (MAPK12)    05163 Human cytomegalovirus infection     108395598 (MAPK12)    05167 Kaposi sarcoma-associated herpesvirus infection     108395598 (MAPK12)    05169 Epstein-Barr virus infection     108395598 (MAPK12)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     108395598 (MAPK12)    05140 Leishmaniasis     108395598 (MAPK12)    05142 Chagas disease     108395598 (MAPK12)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     108395598 (MAPK12)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:mjv01001]     108395598 (MAPK12) Enzymes [BR:mjv01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      108395598 (MAPK12) Protein kinases [BR:mjv01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    108395598 (MAPK12) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like Motif Other DBs NCBI-GeneID:  108395598 NCBI-ProteinID:  XP_017513513 LinkDB All DBs Position Unknown AA seq 409 aa AA seqDB search MEINPAALAEDSPGRFHFWTRAGPAPCSVVREAAGEQSEFSESKGLPLPGWGFYRQEVTK TAWEVRAVYQDLQPVGSGAYGAVCSAVDSRTGAKVAIKKLYRPFQSELFAKRAYRELRLL KHMRHENVIGLLDVFTPDESLDDFTDFYLVMPFMGTDLGKLMKHEKLSEDRVQFLVYQML KGLKYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADSEMTGYVVTRWYRAPEVIL NWMRYTQTVDIWSVGCIMAEMITGKTLFKGNDHLDQLKEILKVTGTPPAEFVQKLQSADA KNYMKGLPELEKKDFTSFLTNASPLAVNLLEKMLVLDAERRATAAEALAHPYFESLQDTE DEPAAHKYDESCDDVDRTLDEWKRVTYKEVLNFKHPQQLGAKASKETAL NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt atggagatcaacccggctgcccttgcagaggactcaccaggcaggttccacttctggacc agagccggacctgccccttgctcagtggtcagggaagctgctggggaacaatcggagttc tcagagagcaaaggcctgcccctcccagggtggggtttctaccgccaggaggtgaccaag acggcctgggaggtgcgcgctgtgtaccaggacctgcagcccgtgggctcgggcgcctat ggcgcggtgtgctcggccgtggacagccgcaccggcgccaaggtggccatcaagaagctg taccggcccttccagtcggagctcttcgccaagcgggcctaccgcgagctgcgcctcctc aagcacatgcgccacgagaacgtgatcgggctgctggacgtgttcactcctgacgagtcc ctggatgatttcacagacttttacctggtaatgccattcatgggcactgacctgggcaag ctcatgaagcatgagaagctgagtgaggaccgagtccagttccttgtctaccagatgcta aaaggcctgaagtatatccacgctgctggcatcatccacagggacctgaagcccggcaac ctggcggtgaatgaggactgtgagctgaagattctggactttggcttggccaggcaggca gacagtgagatgactggatatgtggtgacccggtggtaccgggcacccgaggtcatcctg aattggatgcgctacacacagactgtggacatctggtcagtgggctgcatcatggcggag atgatcacaggcaagacgctgtttaagggcaatgaccacttggaccagctgaaggagatc ctgaaggtgacggggacgccgcctgccgagtttgtgcagaagctgcagagcgctgacgcg aagaactacatgaagggcctccccgagttagagaagaaggatttcacctccttcctgacc aacgcgagccctctggctgtgaacctcctggagaagatgctggtgctggacgcggagcga cgggcgaccgcggccgaggctctggcccacccttacttcgagtcactgcaggacacagag gacgagcccgcggcccacaagtatgacgagtcctgtgacgatgtggaccgcaccctggat gaatggaagcgtgtcacgtataaagaggtgctcaactttaagcacccccagcagctgggt gccaaggcctccaaggagacggcactgtga

Manis javanica (Malayan pangolin): 108395610 Help Entry 108395610         CDS       T06054                                  Gene name MAPK11 Definition (RefSeq) mitogen-activated protein kinase 11   KO K04441   p38 MAP kinase [EC:2.7.11.24] Organism mjv  Manis javanica (Malayan pangolin) Pathway mjv01522   Endocrine resistance mjv04010   MAPK signaling pathway mjv04015   Rap1 signaling pathway mjv04068   FoxO signaling pathway mjv04071   Sphingolipid signaling pathway mjv04114   Oocyte meiosis mjv04218   Cellular senescence mjv04261   Adrenergic signaling in cardiomyocytes mjv04370   VEGF signaling pathway mjv04380   Osteoclast differentiation mjv04550   Signaling pathways regulating pluripotency of stem cells mjv04611   Platelet activation mjv04613   Neutrophil extracellular trap formation mjv04620   Toll-like receptor signaling pathway mjv04621   NOD-like receptor signaling pathway mjv04622   RIG-I-like receptor signaling pathway mjv04625   C-type lectin receptor signaling pathway mjv04657   IL-17 signaling pathway mjv04658   Th1 and Th2 cell differentiation mjv04659   Th17 cell differentiation mjv04660   T cell receptor signaling pathway mjv04664   Fc epsilon RI signaling pathway mjv04668   TNF signaling pathway mjv04670   Leukocyte transendothelial migration mjv04714   Thermogenesis mjv04722   Neurotrophin signaling pathway mjv04723   Retrograde endocannabinoid signaling mjv04728   Dopaminergic synapse mjv04750   Inflammatory mediator regulation of TRP channels mjv04912   GnRH signaling pathway mjv04914   Progesterone-mediated oocyte maturation mjv04917   Prolactin signaling pathway mjv04926   Relaxin signaling pathway mjv04933   AGE-RAGE signaling pathway in diabetic complications mjv04935   Growth hormone synthesis, secretion and action mjv05014   Amyotrophic lateral sclerosis mjv05020   Prion disease mjv05022   Pathways of neurodegeneration - multiple diseases mjv05132   Salmonella infection mjv05133   Pertussis mjv05135   Yersinia infection mjv05140   Leishmaniasis mjv05142   Chagas disease mjv05145   Toxoplasmosis mjv05152   Tuberculosis mjv05161   Hepatitis B mjv05163   Human cytomegalovirus infection mjv05167   Kaposi sarcoma-associated herpesvirus infection mjv05169   Epstein-Barr virus infection mjv05170   Human immunodeficiency virus 1 infection mjv05171   Coronavirus disease - COVID-19 mjv05205   Proteoglycans in cancer mjv05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mjv05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mjv00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     108395610 (MAPK11)    04015 Rap1 signaling pathway     108395610 (MAPK11)    04370 VEGF signaling pathway     108395610 (MAPK11)    04668 TNF signaling pathway     108395610 (MAPK11)    04068 FoxO signaling pathway     108395610 (MAPK11)    04071 Sphingolipid signaling pathway     108395610 (MAPK11)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     108395610 (MAPK11)    04218 Cellular senescence     108395610 (MAPK11)   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     108395610 (MAPK11)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     108395610 (MAPK11)    04613 Neutrophil extracellular trap formation     108395610 (MAPK11)    04620 Toll-like receptor signaling pathway     108395610 (MAPK11)    04621 NOD-like receptor signaling pathway     108395610 (MAPK11)    04622 RIG-I-like receptor signaling pathway     108395610 (MAPK11)    04625 C-type lectin receptor signaling pathway     108395610 (MAPK11)    04660 T cell receptor signaling pathway     108395610 (MAPK11)    04658 Th1 and Th2 cell differentiation     108395610 (MAPK11)    04659 Th17 cell differentiation     108395610 (MAPK11)    04657 IL-17 signaling pathway     108395610 (MAPK11)    04664 Fc epsilon RI signaling pathway     108395610 (MAPK11)    04670 Leukocyte transendothelial migration     108395610 (MAPK11)   09152 Endocrine system    04912 GnRH signaling pathway     108395610 (MAPK11)    04914 Progesterone-mediated oocyte maturation     108395610 (MAPK11)    04917 Prolactin signaling pathway     108395610 (MAPK11)    04926 Relaxin signaling pathway     108395610 (MAPK11)    04935 Growth hormone synthesis, secretion and action     108395610 (MAPK11)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     108395610 (MAPK11)   09156 Nervous system    04728 Dopaminergic synapse     108395610 (MAPK11)    04723 Retrograde endocannabinoid signaling     108395610 (MAPK11)    04722 Neurotrophin signaling pathway     108395610 (MAPK11)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     108395610 (MAPK11)   09158 Development and regeneration    04380 Osteoclast differentiation     108395610 (MAPK11)   09159 Environmental adaptation    04714 Thermogenesis     108395610 (MAPK11)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     108395610 (MAPK11)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     108395610 (MAPK11)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     108395610 (MAPK11)    05020 Prion disease     108395610 (MAPK11)    05022 Pathways of neurodegeneration - multiple diseases     108395610 (MAPK11)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     108395610 (MAPK11)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     108395610 (MAPK11)   09171 Infectious disease: bacterial    05132 Salmonella infection     108395610 (MAPK11)    05135 Yersinia infection     108395610 (MAPK11)    05133 Pertussis     108395610 (MAPK11)    05152 Tuberculosis     108395610 (MAPK11)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     108395610 (MAPK11)    05161 Hepatitis B     108395610 (MAPK11)    05171 Coronavirus disease - COVID-19     108395610 (MAPK11)    05163 Human cytomegalovirus infection     108395610 (MAPK11)    05167 Kaposi sarcoma-associated herpesvirus infection     108395610 (MAPK11)    05169 Epstein-Barr virus infection     108395610 (MAPK11)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     108395610 (MAPK11)    05140 Leishmaniasis     108395610 (MAPK11)    05142 Chagas disease     108395610 (MAPK11)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     108395610 (MAPK11)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:mjv01001]     108395610 (MAPK11) Enzymes [BR:mjv01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      108395610 (MAPK11) Protein kinases [BR:mjv01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    108395610 (MAPK11) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr Kdo APH Cas_CT1975 RIO1 Kinase-like Motif Other DBs NCBI-GeneID:  108395610 NCBI-ProteinID:  XP_017513537 LinkDB All DBs Position Unknown AA seq 427 aa AA seqDB search FKIRGFILKTQILVCFEEPEAGNSEPVSHFPGRGRRSHSSGLRRAQGQGTSVWGAVLSEP WSPYSQRKSRRRAQRARRTRSAYDARLCQQVAVKKLSRPFQSPVHARRTYRELRLLKHLK HENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNSIVKCQALSDEHVQFLVYQLLRGLK YIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMTGYVATRWYRAPEIMLNWMH YNQTVDIWSVGCIMAELLQGVEKQVLGSAPKIWGPGKGLCLASGHFLSQADIDQLKRIME VVGTPSPEVLAKISSEHARTYIQSLPPMPQKDLRSIFHGANPLAVDLLGRMLVLDSDQRV SAAEALAHAYFSQYHDPDDEPEAEPYEEGEEAKERPMAEWKELTYQEVLSFKPREPPKPP GNLGPEQ NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt tttaaaataaggggattcatattaaaaactcagatactagtttgtttcgaagaaccggag gccggcaactcagaacctgtttcccactttcctgggagggggcgacgcagccactcatca gggctccgcagagcacagggtcaggggacgtctgtctggggggcagtgctctccgaaccc tggtcaccgtacagtcagaggaagagtagacggcgggcgcagcgcgctaggcggacacgc tctgcctatgacgcacggctgtgccagcaggttgcggtgaagaagctgtcaagacccttt cagtcaccagtgcacgcgcgaaggacataccgagaactgcggctgctcaagcacctcaag catgagaacgtcattggactgttggatgtgttcacaccggccacgtccatcgaggacttc agcgaagtgtacctggtgaccactctgatgggcgctgacctgaacagcatcgtcaagtgc caggcactgagtgacgagcacgtccagttcctcgtgtaccagctgctgcgtgggctgaag tacatccactcagcggggatcatccatcgggacctgaagcccagcaacgtggctgtgaat gaggactgtgagctcaggattctggactttgggcttgcacgccaggctgatgaggagatg actggctatgtggctacacgctggtaccgtgcacctgagatcatgctcaactggatgcac tacaaccagacagtggacatatggtccgtgggctgcatcatggccgagttgctccagggt gtagaaaagcaggttctgggcagtgccccgaagatctgggggcctgggaagggtctctgc ctggccagtgggcatttcctgagccaggcagacattgaccagctgaagcgcatcatggag gtggtgggcacacccagtcctgaggttctggcaaagatatcctcggaacacgcccggacg tacatccagtccctgccccccatgccccagaaggacctcaggagcatcttccacggagcc aaccccctggctgtggacctcctgggaaggatgctggtgctggacagcgaccagagggtc agtgcagccgaggccctggcccacgcctacttcagccagtaccacgacccagatgatgag cccgaagctgagccttatgaggagggcgaggaggccaaggagcgccccatggccgagtgg aaggagctcacctaccaggaagtcctcagctttaagccccgagaaccaccgaagccgcct ggcaacctgggccctgagcagtga

DBGET integrated database retrieval system