KEGG   Manis javanica (Malayan pangolin): 108394635
Entry
108394635         CDS       T06054                                 

Definition
(RefSeq) mitogen-activated protein kinase 13
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01522  Endocrine resistance
mjv04010  MAPK signaling pathway
mjv04015  Rap1 signaling pathway
mjv04068  FoxO signaling pathway
mjv04071  Sphingolipid signaling pathway
mjv04114  Oocyte meiosis
mjv04218  Cellular senescence
mjv04261  Adrenergic signaling in cardiomyocytes
mjv04370  VEGF signaling pathway
mjv04380  Osteoclast differentiation
mjv04550  Signaling pathways regulating pluripotency of stem cells
mjv04611  Platelet activation
mjv04613  Neutrophil extracellular trap formation
mjv04620  Toll-like receptor signaling pathway
mjv04621  NOD-like receptor signaling pathway
mjv04622  RIG-I-like receptor signaling pathway
mjv04625  C-type lectin receptor signaling pathway
mjv04657  IL-17 signaling pathway
mjv04658  Th1 and Th2 cell differentiation
mjv04659  Th17 cell differentiation
mjv04660  T cell receptor signaling pathway
mjv04664  Fc epsilon RI signaling pathway
mjv04668  TNF signaling pathway
mjv04670  Leukocyte transendothelial migration
mjv04714  Thermogenesis
mjv04722  Neurotrophin signaling pathway
mjv04723  Retrograde endocannabinoid signaling
mjv04728  Dopaminergic synapse
mjv04750  Inflammatory mediator regulation of TRP channels
mjv04912  GnRH signaling pathway
mjv04914  Progesterone-mediated oocyte maturation
mjv04917  Prolactin signaling pathway
mjv04926  Relaxin signaling pathway
mjv04933  AGE-RAGE signaling pathway in diabetic complications
mjv04935  Growth hormone synthesis, secretion and action
mjv05014  Amyotrophic lateral sclerosis
mjv05020  Prion disease
mjv05022  Pathways of neurodegeneration - multiple diseases
mjv05132  Salmonella infection
mjv05133  Pertussis
mjv05135  Yersinia infection
mjv05140  Leishmaniasis
mjv05142  Chagas disease
mjv05145  Toxoplasmosis
mjv05152  Tuberculosis
mjv05161  Hepatitis B
mjv05163  Human cytomegalovirus infection
mjv05167  Kaposi sarcoma-associated herpesvirus infection
mjv05169  Epstein-Barr virus infection
mjv05170  Human immunodeficiency virus 1 infection
mjv05171  Coronavirus disease - COVID-19
mjv05205  Proteoglycans in cancer
mjv05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mjv05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108394635
   04015 Rap1 signaling pathway
    108394635
   04370 VEGF signaling pathway
    108394635
   04668 TNF signaling pathway
    108394635
   04068 FoxO signaling pathway
    108394635
   04071 Sphingolipid signaling pathway
    108394635
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    108394635
   04218 Cellular senescence
    108394635
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    108394635
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    108394635
   04613 Neutrophil extracellular trap formation
    108394635
   04620 Toll-like receptor signaling pathway
    108394635
   04621 NOD-like receptor signaling pathway
    108394635
   04622 RIG-I-like receptor signaling pathway
    108394635
   04625 C-type lectin receptor signaling pathway
    108394635
   04660 T cell receptor signaling pathway
    108394635
   04658 Th1 and Th2 cell differentiation
    108394635
   04659 Th17 cell differentiation
    108394635
   04657 IL-17 signaling pathway
    108394635
   04664 Fc epsilon RI signaling pathway
    108394635
   04670 Leukocyte transendothelial migration
    108394635
  09152 Endocrine system
   04912 GnRH signaling pathway
    108394635
   04914 Progesterone-mediated oocyte maturation
    108394635
   04917 Prolactin signaling pathway
    108394635
   04926 Relaxin signaling pathway
    108394635
   04935 Growth hormone synthesis, secretion and action
    108394635
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108394635
  09156 Nervous system
   04728 Dopaminergic synapse
    108394635
   04723 Retrograde endocannabinoid signaling
    108394635
   04722 Neurotrophin signaling pathway
    108394635
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    108394635
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108394635
  09159 Environmental adaptation
   04714 Thermogenesis
    108394635
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    108394635
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108394635
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    108394635
   05020 Prion disease
    108394635
   05022 Pathways of neurodegeneration - multiple diseases
    108394635
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108394635
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    108394635
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108394635
   05135 Yersinia infection
    108394635
   05133 Pertussis
    108394635
   05152 Tuberculosis
    108394635
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108394635
   05161 Hepatitis B
    108394635
   05171 Coronavirus disease - COVID-19
    108394635
   05163 Human cytomegalovirus infection
    108394635
   05167 Kaposi sarcoma-associated herpesvirus infection
    108394635
   05169 Epstein-Barr virus infection
    108394635
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108394635
   05140 Leishmaniasis
    108394635
   05142 Chagas disease
    108394635
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    108394635
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mjv01001]
    108394635
Enzymes [BR:mjv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     108394635
Protein kinases [BR:mjv01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   108394635
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like
Other DBs
NCBI-GeneID: 108394635
NCBI-ProteinID: XP_017511791
LinkDB
Position
Unknown
AA seq 366 aa
MNLTRKKGFYKQDVNRTAWELPKTYVSPTHLGSGAYGSVCSAIDKRSGEKVAIKKLSRPF
QSEIFAKRAYRELLLLKHMQHENVIGLLDVFTSASSLRSFHDFYLVMPFMQTDLQKIMGM
EFSEDKIQYLVYQMLKGLKYIHSAGVIHRDLKPGNLAVNEDCELKILDFGLARPADAEMT
GYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTG
VPGAEFVQKLKDKAAKSYIQALPQSPKKDFSQLFPQASSQAIDLLEKMLELDVDKRLTAS
QALTHPFFEPFRDPEEETEVQQPFDDSLEHEKFTVDEWKQHIYKEIVNFRPIARKDSRRR
SGMKLQ
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgaacctcacccggaaaaaaggcttctacaagcaggacgtcaacaggaccgcctgggag
ctgcccaagacctacgtgtccccgacgcacttgggcagcggggcctacggctccgtgtgc
tcagccatcgacaagcggtcaggggagaaggtggccatcaagaagctgagccggcccttc
cagtccgagatctttgccaagcgggcctaccgggagctgctcctgctgaaacacatgcag
catgagaatgttatcgggctcctggatgtcttcacctcagcctcctccctgcgcagcttc
catgacttctacctggtaatgcccttcatgcagacggacctgcagaagatcatggggatg
gagttcagcgaggacaagatccagtacctggtgtatcagatgctcaagggtcttaagtac
atccactcagctggcgtcatccacagggacctgaagccgggcaaccttgctgtgaacgag
gactgtgagctgaagatcttggattttgggctggcaaggcctgcagacgcagagatgacg
ggctatgtggtgacccgctggtaccgggcccccgaggtgatcctcagctggatgcactat
aaccagactgtggacatctggtctgtgggctgtatcatggcagagatgctgacaggaaaa
actctgttcaaagggaaagattacctcgaccagctgacccagatcctgaaggtgactggg
gtgccgggtgcagagtttgtgcagaagttgaaggacaaagcggccaaatcctatatccag
gccctgccacagagccctaagaaggatttctctcagctcttcccacaagccagctcccag
gccatagatctgctagagaagatgctggagctggatgtggacaagcgcctgacagcctcg
caggccctcacccaccccttctttgaacccttccgggacccggaggaggagacggaggtt
cagcagccatttgatgattccttagaacatgagaaatttacagtggacgagtggaagcag
cacatttacaaggagattgtgaacttcagacccattgcccggaaggactcacggcgccgg
agtggcatgaagctgcagtga

KEGG   Manis javanica (Malayan pangolin): 108394636
Entry
108394636         CDS       T06054                                 

Gene name
MAPK14
Definition
(RefSeq) mitogen-activated protein kinase 14
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01522  Endocrine resistance
mjv04010  MAPK signaling pathway
mjv04015  Rap1 signaling pathway
mjv04068  FoxO signaling pathway
mjv04071  Sphingolipid signaling pathway
mjv04114  Oocyte meiosis
mjv04218  Cellular senescence
mjv04261  Adrenergic signaling in cardiomyocytes
mjv04370  VEGF signaling pathway
mjv04380  Osteoclast differentiation
mjv04550  Signaling pathways regulating pluripotency of stem cells
mjv04611  Platelet activation
mjv04613  Neutrophil extracellular trap formation
mjv04620  Toll-like receptor signaling pathway
mjv04621  NOD-like receptor signaling pathway
mjv04622  RIG-I-like receptor signaling pathway
mjv04625  C-type lectin receptor signaling pathway
mjv04657  IL-17 signaling pathway
mjv04658  Th1 and Th2 cell differentiation
mjv04659  Th17 cell differentiation
mjv04660  T cell receptor signaling pathway
mjv04664  Fc epsilon RI signaling pathway
mjv04668  TNF signaling pathway
mjv04670  Leukocyte transendothelial migration
mjv04714  Thermogenesis
mjv04722  Neurotrophin signaling pathway
mjv04723  Retrograde endocannabinoid signaling
mjv04728  Dopaminergic synapse
mjv04750  Inflammatory mediator regulation of TRP channels
mjv04912  GnRH signaling pathway
mjv04914  Progesterone-mediated oocyte maturation
mjv04917  Prolactin signaling pathway
mjv04926  Relaxin signaling pathway
mjv04933  AGE-RAGE signaling pathway in diabetic complications
mjv04935  Growth hormone synthesis, secretion and action
mjv05014  Amyotrophic lateral sclerosis
mjv05020  Prion disease
mjv05022  Pathways of neurodegeneration - multiple diseases
mjv05132  Salmonella infection
mjv05133  Pertussis
mjv05135  Yersinia infection
mjv05140  Leishmaniasis
mjv05142  Chagas disease
mjv05145  Toxoplasmosis
mjv05152  Tuberculosis
mjv05161  Hepatitis B
mjv05163  Human cytomegalovirus infection
mjv05167  Kaposi sarcoma-associated herpesvirus infection
mjv05169  Epstein-Barr virus infection
mjv05170  Human immunodeficiency virus 1 infection
mjv05171  Coronavirus disease - COVID-19
mjv05205  Proteoglycans in cancer
mjv05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mjv05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108394636 (MAPK14)
   04015 Rap1 signaling pathway
    108394636 (MAPK14)
   04370 VEGF signaling pathway
    108394636 (MAPK14)
   04668 TNF signaling pathway
    108394636 (MAPK14)
   04068 FoxO signaling pathway
    108394636 (MAPK14)
   04071 Sphingolipid signaling pathway
    108394636 (MAPK14)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    108394636 (MAPK14)
   04218 Cellular senescence
    108394636 (MAPK14)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    108394636 (MAPK14)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    108394636 (MAPK14)
   04613 Neutrophil extracellular trap formation
    108394636 (MAPK14)
   04620 Toll-like receptor signaling pathway
    108394636 (MAPK14)
   04621 NOD-like receptor signaling pathway
    108394636 (MAPK14)
   04622 RIG-I-like receptor signaling pathway
    108394636 (MAPK14)
   04625 C-type lectin receptor signaling pathway
    108394636 (MAPK14)
   04660 T cell receptor signaling pathway
    108394636 (MAPK14)
   04658 Th1 and Th2 cell differentiation
    108394636 (MAPK14)
   04659 Th17 cell differentiation
    108394636 (MAPK14)
   04657 IL-17 signaling pathway
    108394636 (MAPK14)
   04664 Fc epsilon RI signaling pathway
    108394636 (MAPK14)
   04670 Leukocyte transendothelial migration
    108394636 (MAPK14)
  09152 Endocrine system
   04912 GnRH signaling pathway
    108394636 (MAPK14)
   04914 Progesterone-mediated oocyte maturation
    108394636 (MAPK14)
   04917 Prolactin signaling pathway
    108394636 (MAPK14)
   04926 Relaxin signaling pathway
    108394636 (MAPK14)
   04935 Growth hormone synthesis, secretion and action
    108394636 (MAPK14)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108394636 (MAPK14)
  09156 Nervous system
   04728 Dopaminergic synapse
    108394636 (MAPK14)
   04723 Retrograde endocannabinoid signaling
    108394636 (MAPK14)
   04722 Neurotrophin signaling pathway
    108394636 (MAPK14)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    108394636 (MAPK14)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108394636 (MAPK14)
  09159 Environmental adaptation
   04714 Thermogenesis
    108394636 (MAPK14)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    108394636 (MAPK14)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108394636 (MAPK14)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    108394636 (MAPK14)
   05020 Prion disease
    108394636 (MAPK14)
   05022 Pathways of neurodegeneration - multiple diseases
    108394636 (MAPK14)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108394636 (MAPK14)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    108394636 (MAPK14)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108394636 (MAPK14)
   05135 Yersinia infection
    108394636 (MAPK14)
   05133 Pertussis
    108394636 (MAPK14)
   05152 Tuberculosis
    108394636 (MAPK14)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108394636 (MAPK14)
   05161 Hepatitis B
    108394636 (MAPK14)
   05171 Coronavirus disease - COVID-19
    108394636 (MAPK14)
   05163 Human cytomegalovirus infection
    108394636 (MAPK14)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108394636 (MAPK14)
   05169 Epstein-Barr virus infection
    108394636 (MAPK14)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108394636 (MAPK14)
   05140 Leishmaniasis
    108394636 (MAPK14)
   05142 Chagas disease
    108394636 (MAPK14)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    108394636 (MAPK14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mjv01001]
    108394636 (MAPK14)
Enzymes [BR:mjv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     108394636 (MAPK14)
Protein kinases [BR:mjv01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   108394636 (MAPK14)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kinase-like Kdo
Other DBs
NCBI-GeneID: 108394636
NCBI-ProteinID: XP_017511792
LinkDB
Position
Unknown
AA seq 283 aa
MKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRG
LKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNW
MHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARN
YIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITATQALAHAYFAQYHDPDDE
PVADPYDQSFESRDLLIDEWKSLTYGEVISFVPPPLDQEEMES
NT seq 852 nt   +upstreamnt  +downstreamnt
atgaaacatgaaaatgtgattggtctgttggatgttttcacacctgcaaggtctctggag
gagttcaatgatgtgtatttggtgacccatctcatgggggcagatctgaacaacattgtg
aagtgtcagaagcttacagatgaccatgttcagtttcttatttaccaaattctccgaggc
ctcaagtatatacattcagctgacataattcacagggacctaaaacctagtaatctagct
gtgaatgaagactgtgagctgaagatcttggattttggactggctcgacacacagatgat
gaaatgacaggctacgtggccactaggtggtacagggctcctgagatcatgctgaattgg
atgcattacaaccagacagttgatatttggtcagtgggatgcataatggccgagctgttg
actggaagaacattgtttcctggtacagaccatattgatcagttgaagctcattttaaga
ctcgttggaaccccaggggctgagcttttgaagaaaatctcctcagagtctgcaagaaac
tacattcagtctttgacccagatgccgaagatgaactttgcaaatgtatttattggtgcc
aatcccttggctgtcgacttgctggagaagatgcttgtattagactcagacaagagaatc
acagccacccaagcccttgcgcatgcctactttgctcagtaccacgatcctgatgatgaa
ccagtggctgatccttacgatcagtcctttgaaagcagggacctccttatagatgaatgg
aaaagcctgacctacggtgaagtcatcagctttgtgcccccgccccttgaccaagaagag
atggaatcttga

KEGG   Manis javanica (Malayan pangolin): 108395598
Entry
108395598         CDS       T06054                                 

Gene name
MAPK12
Definition
(RefSeq) mitogen-activated protein kinase 12
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01522  Endocrine resistance
mjv04010  MAPK signaling pathway
mjv04015  Rap1 signaling pathway
mjv04068  FoxO signaling pathway
mjv04071  Sphingolipid signaling pathway
mjv04114  Oocyte meiosis
mjv04218  Cellular senescence
mjv04261  Adrenergic signaling in cardiomyocytes
mjv04370  VEGF signaling pathway
mjv04380  Osteoclast differentiation
mjv04550  Signaling pathways regulating pluripotency of stem cells
mjv04611  Platelet activation
mjv04613  Neutrophil extracellular trap formation
mjv04620  Toll-like receptor signaling pathway
mjv04621  NOD-like receptor signaling pathway
mjv04622  RIG-I-like receptor signaling pathway
mjv04625  C-type lectin receptor signaling pathway
mjv04657  IL-17 signaling pathway
mjv04658  Th1 and Th2 cell differentiation
mjv04659  Th17 cell differentiation
mjv04660  T cell receptor signaling pathway
mjv04664  Fc epsilon RI signaling pathway
mjv04668  TNF signaling pathway
mjv04670  Leukocyte transendothelial migration
mjv04714  Thermogenesis
mjv04722  Neurotrophin signaling pathway
mjv04723  Retrograde endocannabinoid signaling
mjv04728  Dopaminergic synapse
mjv04750  Inflammatory mediator regulation of TRP channels
mjv04912  GnRH signaling pathway
mjv04914  Progesterone-mediated oocyte maturation
mjv04917  Prolactin signaling pathway
mjv04926  Relaxin signaling pathway
mjv04933  AGE-RAGE signaling pathway in diabetic complications
mjv04935  Growth hormone synthesis, secretion and action
mjv05014  Amyotrophic lateral sclerosis
mjv05020  Prion disease
mjv05022  Pathways of neurodegeneration - multiple diseases
mjv05132  Salmonella infection
mjv05133  Pertussis
mjv05135  Yersinia infection
mjv05140  Leishmaniasis
mjv05142  Chagas disease
mjv05145  Toxoplasmosis
mjv05152  Tuberculosis
mjv05161  Hepatitis B
mjv05163  Human cytomegalovirus infection
mjv05167  Kaposi sarcoma-associated herpesvirus infection
mjv05169  Epstein-Barr virus infection
mjv05170  Human immunodeficiency virus 1 infection
mjv05171  Coronavirus disease - COVID-19
mjv05205  Proteoglycans in cancer
mjv05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mjv05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108395598 (MAPK12)
   04015 Rap1 signaling pathway
    108395598 (MAPK12)
   04370 VEGF signaling pathway
    108395598 (MAPK12)
   04668 TNF signaling pathway
    108395598 (MAPK12)
   04068 FoxO signaling pathway
    108395598 (MAPK12)
   04071 Sphingolipid signaling pathway
    108395598 (MAPK12)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    108395598 (MAPK12)
   04218 Cellular senescence
    108395598 (MAPK12)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    108395598 (MAPK12)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    108395598 (MAPK12)
   04613 Neutrophil extracellular trap formation
    108395598 (MAPK12)
   04620 Toll-like receptor signaling pathway
    108395598 (MAPK12)
   04621 NOD-like receptor signaling pathway
    108395598 (MAPK12)
   04622 RIG-I-like receptor signaling pathway
    108395598 (MAPK12)
   04625 C-type lectin receptor signaling pathway
    108395598 (MAPK12)
   04660 T cell receptor signaling pathway
    108395598 (MAPK12)
   04658 Th1 and Th2 cell differentiation
    108395598 (MAPK12)
   04659 Th17 cell differentiation
    108395598 (MAPK12)
   04657 IL-17 signaling pathway
    108395598 (MAPK12)
   04664 Fc epsilon RI signaling pathway
    108395598 (MAPK12)
   04670 Leukocyte transendothelial migration
    108395598 (MAPK12)
  09152 Endocrine system
   04912 GnRH signaling pathway
    108395598 (MAPK12)
   04914 Progesterone-mediated oocyte maturation
    108395598 (MAPK12)
   04917 Prolactin signaling pathway
    108395598 (MAPK12)
   04926 Relaxin signaling pathway
    108395598 (MAPK12)
   04935 Growth hormone synthesis, secretion and action
    108395598 (MAPK12)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108395598 (MAPK12)
  09156 Nervous system
   04728 Dopaminergic synapse
    108395598 (MAPK12)
   04723 Retrograde endocannabinoid signaling
    108395598 (MAPK12)
   04722 Neurotrophin signaling pathway
    108395598 (MAPK12)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    108395598 (MAPK12)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108395598 (MAPK12)
  09159 Environmental adaptation
   04714 Thermogenesis
    108395598 (MAPK12)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    108395598 (MAPK12)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108395598 (MAPK12)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    108395598 (MAPK12)
   05020 Prion disease
    108395598 (MAPK12)
   05022 Pathways of neurodegeneration - multiple diseases
    108395598 (MAPK12)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108395598 (MAPK12)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    108395598 (MAPK12)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108395598 (MAPK12)
   05135 Yersinia infection
    108395598 (MAPK12)
   05133 Pertussis
    108395598 (MAPK12)
   05152 Tuberculosis
    108395598 (MAPK12)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108395598 (MAPK12)
   05161 Hepatitis B
    108395598 (MAPK12)
   05171 Coronavirus disease - COVID-19
    108395598 (MAPK12)
   05163 Human cytomegalovirus infection
    108395598 (MAPK12)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108395598 (MAPK12)
   05169 Epstein-Barr virus infection
    108395598 (MAPK12)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108395598 (MAPK12)
   05140 Leishmaniasis
    108395598 (MAPK12)
   05142 Chagas disease
    108395598 (MAPK12)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    108395598 (MAPK12)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mjv01001]
    108395598 (MAPK12)
Enzymes [BR:mjv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     108395598 (MAPK12)
Protein kinases [BR:mjv01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   108395598 (MAPK12)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like
Other DBs
NCBI-GeneID: 108395598
NCBI-ProteinID: XP_017513513
LinkDB
Position
Unknown
AA seq 409 aa
MEINPAALAEDSPGRFHFWTRAGPAPCSVVREAAGEQSEFSESKGLPLPGWGFYRQEVTK
TAWEVRAVYQDLQPVGSGAYGAVCSAVDSRTGAKVAIKKLYRPFQSELFAKRAYRELRLL
KHMRHENVIGLLDVFTPDESLDDFTDFYLVMPFMGTDLGKLMKHEKLSEDRVQFLVYQML
KGLKYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADSEMTGYVVTRWYRAPEVIL
NWMRYTQTVDIWSVGCIMAEMITGKTLFKGNDHLDQLKEILKVTGTPPAEFVQKLQSADA
KNYMKGLPELEKKDFTSFLTNASPLAVNLLEKMLVLDAERRATAAEALAHPYFESLQDTE
DEPAAHKYDESCDDVDRTLDEWKRVTYKEVLNFKHPQQLGAKASKETAL
NT seq 1230 nt   +upstreamnt  +downstreamnt
atggagatcaacccggctgcccttgcagaggactcaccaggcaggttccacttctggacc
agagccggacctgccccttgctcagtggtcagggaagctgctggggaacaatcggagttc
tcagagagcaaaggcctgcccctcccagggtggggtttctaccgccaggaggtgaccaag
acggcctgggaggtgcgcgctgtgtaccaggacctgcagcccgtgggctcgggcgcctat
ggcgcggtgtgctcggccgtggacagccgcaccggcgccaaggtggccatcaagaagctg
taccggcccttccagtcggagctcttcgccaagcgggcctaccgcgagctgcgcctcctc
aagcacatgcgccacgagaacgtgatcgggctgctggacgtgttcactcctgacgagtcc
ctggatgatttcacagacttttacctggtaatgccattcatgggcactgacctgggcaag
ctcatgaagcatgagaagctgagtgaggaccgagtccagttccttgtctaccagatgcta
aaaggcctgaagtatatccacgctgctggcatcatccacagggacctgaagcccggcaac
ctggcggtgaatgaggactgtgagctgaagattctggactttggcttggccaggcaggca
gacagtgagatgactggatatgtggtgacccggtggtaccgggcacccgaggtcatcctg
aattggatgcgctacacacagactgtggacatctggtcagtgggctgcatcatggcggag
atgatcacaggcaagacgctgtttaagggcaatgaccacttggaccagctgaaggagatc
ctgaaggtgacggggacgccgcctgccgagtttgtgcagaagctgcagagcgctgacgcg
aagaactacatgaagggcctccccgagttagagaagaaggatttcacctccttcctgacc
aacgcgagccctctggctgtgaacctcctggagaagatgctggtgctggacgcggagcga
cgggcgaccgcggccgaggctctggcccacccttacttcgagtcactgcaggacacagag
gacgagcccgcggcccacaagtatgacgagtcctgtgacgatgtggaccgcaccctggat
gaatggaagcgtgtcacgtataaagaggtgctcaactttaagcacccccagcagctgggt
gccaaggcctccaaggagacggcactgtga

KEGG   Manis javanica (Malayan pangolin): 108395610
Entry
108395610         CDS       T06054                                 

Gene name
MAPK11
Definition
(RefSeq) mitogen-activated protein kinase 11
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01522  Endocrine resistance
mjv04010  MAPK signaling pathway
mjv04015  Rap1 signaling pathway
mjv04068  FoxO signaling pathway
mjv04071  Sphingolipid signaling pathway
mjv04114  Oocyte meiosis
mjv04218  Cellular senescence
mjv04261  Adrenergic signaling in cardiomyocytes
mjv04370  VEGF signaling pathway
mjv04380  Osteoclast differentiation
mjv04550  Signaling pathways regulating pluripotency of stem cells
mjv04611  Platelet activation
mjv04613  Neutrophil extracellular trap formation
mjv04620  Toll-like receptor signaling pathway
mjv04621  NOD-like receptor signaling pathway
mjv04622  RIG-I-like receptor signaling pathway
mjv04625  C-type lectin receptor signaling pathway
mjv04657  IL-17 signaling pathway
mjv04658  Th1 and Th2 cell differentiation
mjv04659  Th17 cell differentiation
mjv04660  T cell receptor signaling pathway
mjv04664  Fc epsilon RI signaling pathway
mjv04668  TNF signaling pathway
mjv04670  Leukocyte transendothelial migration
mjv04714  Thermogenesis
mjv04722  Neurotrophin signaling pathway
mjv04723  Retrograde endocannabinoid signaling
mjv04728  Dopaminergic synapse
mjv04750  Inflammatory mediator regulation of TRP channels
mjv04912  GnRH signaling pathway
mjv04914  Progesterone-mediated oocyte maturation
mjv04917  Prolactin signaling pathway
mjv04926  Relaxin signaling pathway
mjv04933  AGE-RAGE signaling pathway in diabetic complications
mjv04935  Growth hormone synthesis, secretion and action
mjv05014  Amyotrophic lateral sclerosis
mjv05020  Prion disease
mjv05022  Pathways of neurodegeneration - multiple diseases
mjv05132  Salmonella infection
mjv05133  Pertussis
mjv05135  Yersinia infection
mjv05140  Leishmaniasis
mjv05142  Chagas disease
mjv05145  Toxoplasmosis
mjv05152  Tuberculosis
mjv05161  Hepatitis B
mjv05163  Human cytomegalovirus infection
mjv05167  Kaposi sarcoma-associated herpesvirus infection
mjv05169  Epstein-Barr virus infection
mjv05170  Human immunodeficiency virus 1 infection
mjv05171  Coronavirus disease - COVID-19
mjv05205  Proteoglycans in cancer
mjv05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mjv05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108395610 (MAPK11)
   04015 Rap1 signaling pathway
    108395610 (MAPK11)
   04370 VEGF signaling pathway
    108395610 (MAPK11)
   04668 TNF signaling pathway
    108395610 (MAPK11)
   04068 FoxO signaling pathway
    108395610 (MAPK11)
   04071 Sphingolipid signaling pathway
    108395610 (MAPK11)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    108395610 (MAPK11)
   04218 Cellular senescence
    108395610 (MAPK11)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    108395610 (MAPK11)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    108395610 (MAPK11)
   04613 Neutrophil extracellular trap formation
    108395610 (MAPK11)
   04620 Toll-like receptor signaling pathway
    108395610 (MAPK11)
   04621 NOD-like receptor signaling pathway
    108395610 (MAPK11)
   04622 RIG-I-like receptor signaling pathway
    108395610 (MAPK11)
   04625 C-type lectin receptor signaling pathway
    108395610 (MAPK11)
   04660 T cell receptor signaling pathway
    108395610 (MAPK11)
   04658 Th1 and Th2 cell differentiation
    108395610 (MAPK11)
   04659 Th17 cell differentiation
    108395610 (MAPK11)
   04657 IL-17 signaling pathway
    108395610 (MAPK11)
   04664 Fc epsilon RI signaling pathway
    108395610 (MAPK11)
   04670 Leukocyte transendothelial migration
    108395610 (MAPK11)
  09152 Endocrine system
   04912 GnRH signaling pathway
    108395610 (MAPK11)
   04914 Progesterone-mediated oocyte maturation
    108395610 (MAPK11)
   04917 Prolactin signaling pathway
    108395610 (MAPK11)
   04926 Relaxin signaling pathway
    108395610 (MAPK11)
   04935 Growth hormone synthesis, secretion and action
    108395610 (MAPK11)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108395610 (MAPK11)
  09156 Nervous system
   04728 Dopaminergic synapse
    108395610 (MAPK11)
   04723 Retrograde endocannabinoid signaling
    108395610 (MAPK11)
   04722 Neurotrophin signaling pathway
    108395610 (MAPK11)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    108395610 (MAPK11)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108395610 (MAPK11)
  09159 Environmental adaptation
   04714 Thermogenesis
    108395610 (MAPK11)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    108395610 (MAPK11)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108395610 (MAPK11)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    108395610 (MAPK11)
   05020 Prion disease
    108395610 (MAPK11)
   05022 Pathways of neurodegeneration - multiple diseases
    108395610 (MAPK11)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108395610 (MAPK11)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    108395610 (MAPK11)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108395610 (MAPK11)
   05135 Yersinia infection
    108395610 (MAPK11)
   05133 Pertussis
    108395610 (MAPK11)
   05152 Tuberculosis
    108395610 (MAPK11)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108395610 (MAPK11)
   05161 Hepatitis B
    108395610 (MAPK11)
   05171 Coronavirus disease - COVID-19
    108395610 (MAPK11)
   05163 Human cytomegalovirus infection
    108395610 (MAPK11)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108395610 (MAPK11)
   05169 Epstein-Barr virus infection
    108395610 (MAPK11)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108395610 (MAPK11)
   05140 Leishmaniasis
    108395610 (MAPK11)
   05142 Chagas disease
    108395610 (MAPK11)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    108395610 (MAPK11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mjv01001]
    108395610 (MAPK11)
Enzymes [BR:mjv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     108395610 (MAPK11)
Protein kinases [BR:mjv01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   108395610 (MAPK11)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH Cas_CT1975 RIO1 Kinase-like
Other DBs
NCBI-GeneID: 108395610
NCBI-ProteinID: XP_017513537
LinkDB
Position
Unknown
AA seq 427 aa
FKIRGFILKTQILVCFEEPEAGNSEPVSHFPGRGRRSHSSGLRRAQGQGTSVWGAVLSEP
WSPYSQRKSRRRAQRARRTRSAYDARLCQQVAVKKLSRPFQSPVHARRTYRELRLLKHLK
HENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNSIVKCQALSDEHVQFLVYQLLRGLK
YIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMTGYVATRWYRAPEIMLNWMH
YNQTVDIWSVGCIMAELLQGVEKQVLGSAPKIWGPGKGLCLASGHFLSQADIDQLKRIME
VVGTPSPEVLAKISSEHARTYIQSLPPMPQKDLRSIFHGANPLAVDLLGRMLVLDSDQRV
SAAEALAHAYFSQYHDPDDEPEAEPYEEGEEAKERPMAEWKELTYQEVLSFKPREPPKPP
GNLGPEQ
NT seq 1284 nt   +upstreamnt  +downstreamnt
tttaaaataaggggattcatattaaaaactcagatactagtttgtttcgaagaaccggag
gccggcaactcagaacctgtttcccactttcctgggagggggcgacgcagccactcatca
gggctccgcagagcacagggtcaggggacgtctgtctggggggcagtgctctccgaaccc
tggtcaccgtacagtcagaggaagagtagacggcgggcgcagcgcgctaggcggacacgc
tctgcctatgacgcacggctgtgccagcaggttgcggtgaagaagctgtcaagacccttt
cagtcaccagtgcacgcgcgaaggacataccgagaactgcggctgctcaagcacctcaag
catgagaacgtcattggactgttggatgtgttcacaccggccacgtccatcgaggacttc
agcgaagtgtacctggtgaccactctgatgggcgctgacctgaacagcatcgtcaagtgc
caggcactgagtgacgagcacgtccagttcctcgtgtaccagctgctgcgtgggctgaag
tacatccactcagcggggatcatccatcgggacctgaagcccagcaacgtggctgtgaat
gaggactgtgagctcaggattctggactttgggcttgcacgccaggctgatgaggagatg
actggctatgtggctacacgctggtaccgtgcacctgagatcatgctcaactggatgcac
tacaaccagacagtggacatatggtccgtgggctgcatcatggccgagttgctccagggt
gtagaaaagcaggttctgggcagtgccccgaagatctgggggcctgggaagggtctctgc
ctggccagtgggcatttcctgagccaggcagacattgaccagctgaagcgcatcatggag
gtggtgggcacacccagtcctgaggttctggcaaagatatcctcggaacacgcccggacg
tacatccagtccctgccccccatgccccagaaggacctcaggagcatcttccacggagcc
aaccccctggctgtggacctcctgggaaggatgctggtgctggacagcgaccagagggtc
agtgcagccgaggccctggcccacgcctacttcagccagtaccacgacccagatgatgag
cccgaagctgagccttatgaggagggcgaggaggccaaggagcgccccatggccgagtgg
aaggagctcacctaccaggaagtcctcagctttaagccccgagaaccaccgaagccgcct
ggcaacctgggccctgagcagtga

DBGET integrated database retrieval system