KEGG   Manis javanica (Malayan pangolin): 108394726
Entry
108394726         CDS       T06054                                 

Gene name
ATM
Definition
(RefSeq) serine-protein kinase ATM
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01524  Platinum drug resistance
mjv03440  Homologous recombination
mjv04064  NF-kappa B signaling pathway
mjv04068  FoxO signaling pathway
mjv04110  Cell cycle
mjv04115  p53 signaling pathway
mjv04210  Apoptosis
mjv04218  Cellular senescence
mjv05165  Human papillomavirus infection
mjv05166  Human T-cell leukemia virus 1 infection
mjv05170  Human immunodeficiency virus 1 infection
mjv05202  Transcriptional misregulation in cancer
mjv05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    108394726 (ATM)
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    108394726 (ATM)
   04068 FoxO signaling pathway
    108394726 (ATM)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108394726 (ATM)
   04210 Apoptosis
    108394726 (ATM)
   04115 p53 signaling pathway
    108394726 (ATM)
   04218 Cellular senescence
    108394726 (ATM)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    108394726 (ATM)
   05206 MicroRNAs in cancer
    108394726 (ATM)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108394726 (ATM)
   05170 Human immunodeficiency virus 1 infection
    108394726 (ATM)
   05165 Human papillomavirus infection
    108394726 (ATM)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108394726 (ATM)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mjv01001]
    108394726 (ATM)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mjv03032]
    108394726 (ATM)
   03400 DNA repair and recombination proteins [BR:mjv03400]
    108394726 (ATM)
Enzymes [BR:mjv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108394726 (ATM)
Protein kinases [BR:mjv01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   108394726 (ATM)
DNA replication proteins [BR:mjv03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     108394726 (ATM)
DNA repair and recombination proteins [BR:mjv03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    108394726 (ATM)
SSDB
Motif
Pfam: PI3_PI4_kinase FAT FATC
Other DBs
NCBI-GeneID: 108394726
NCBI-ProteinID: XP_017511948
LinkDB
Position
Unknown
AA seq 2952 aa
MQSDLESVPYALEKNVCLLLLELFSVYFRLYLKPSQDINRVLVARIIEAVTKGNCSQTDG
LNCRFLEYFSKAIQHARQEKSSPGLNHILAALIIFLKTLAVNFRIQVCELGDEILPTLLY
IWTQHRLNDSLKEVIIELFQLQIYIHHPKGAKTQGKGSYESRKWKNILYNLYDMLVNEIS
HIGSRGKYSSGSRNIAVKENLIELMADVCHQVFNEDSRALEISLSYTTTQREFSDYSAPC
KKKKIELGWEVIKDHLQKSQNDFDLVPWLQIATQLISKYPASLPSYELSPVLMILYQLLP
QQRHGERTPYVLRCLTEVALCQGKKSNLESLQKSDLLKLWIKIWSITFRGITSERIQAEN
FGLLGAIIQGSLIEVDKEFWKLFTGSTCRPSCPAVCCLTVALTIFVVPETVNTGMDQNIC
EVNRSFSLKELIMKWLLFCQLEDDFEESTELPPILHSNFPHLALEKILVSLTMKNCKAAM
IFFQSMPECEHHQKDEEEPSFTEVEELFLQTTLDNMDFLTTVEECAIEKHQSSPGFSVHQ
NLKVSLDHYLLGLAEQLLNNYSPETTNSETLVRCSSLLVGVLSCYCYVGIIAEEEAYESE
LFQKAKSLMQCAGEIITLFKNKTNEESRIVSVRNMMNLCTSCLCHCTQHSPNKIASGFFL
RLLTSKLMNDIADICRSLASFIKKPFEYGEIESVEEDTDENRMDIEDQSSMNLFNDYPVD
SVSDANESGESQGIIGAMNPLAEEHLSKQDLLLLDMLKFLCICVTTAQANTVSFRAADIR
RKLLMLIDSSMLDPTKSLHLHMYLVLLKELPGEEYPLPMEDVVELLKPLSSVCSLYRRDQ
DVCKTILNHVVHVVMNLCPGSMDPENTSDAQGQFLTVIGAFWHLTNEGKCIFSVRMALVK
CLKTLLEADPYSKWAILNVMGKDFPVNEVFPQFLADNHHQVRMLAAVSINRLFQDVKQRG
SSTLLKALPLKLQQTAFENAYSKAQEGMKEVSHRAANPELLDEIYNRKSVLLMMIAVVLY
CSPICEKQALFALCKSVKENGLEPYLIKKVLEKVSETFGYRRLEDFMASHLDYLVLEWLN
LQDSEYNLSSFPFILLNYTNVEDFYRSCYKVLIPHLVIRSHFDEVKSIADQIQEDWKSLL
TDCFPKILVNILPYFAYEGTGDSGMAQQRETATKVYDMLKDENILGKQIDHLFISNLPEI
VVELLMTFHEPGTSGTSQGTSGDLDPAPNPPHFPSHVIKATFAYISNCHKTKLKSILEIL
SKSPDSYQKILLAICQQAAETNNIYKKHRILKIYHLFVSLLLKDIKSGLGGAWAFVLRDV
IYTLIHTINKRPSRFMDVSLRSFSLCCDLLSRVCHTAVTYCKDALENHLHVIVGTLIPLV
DDQMEVQEQVLDLLKYLVIDNKDNENLYMTIKLLDPFPDHVVFKDLHITQQKIKYSRGPF
SLLEEINHFLSVSVYGALPLTRLEGLKDLRRQLEQHKDQMMDLMRASQDNPQDGIMVKLV
VSLLQLSKMAINHTGEREVLEAVGSCLGEVGPIDFSTIAIQHNRDKSYIKALELFEDKEL
QWTFIMLNYLNNTLVEDCVNVRSAAVICLKSILATKTGHHFWEIYKTTTDPMLIYLQPFR
TSRKKFLEVPRLDRENPLEGLDDTSLWIPQSENHDVWIKTLTCAVLDSGGIQSEILQLLK
PLCEVKSDFCQTVLPYLIHDILLQDTNDSWRKLLSTHIQGFFTNCFRHISQTSQSMIPAN
LDSESEPFFRCWKKSQRTMLAVVDYMRRQKRPSLGTVYDDAFWLELNYLEVAKVAQSCAA
HFTALLYAEIYADKKSMDDQEKSRDSRDRRGNWQVRRDFVLPADMLATRRRQLPSLYYYE
KEEEPCSIQNPSNSRKKARLPGITSHYWTWKPACTCFIDLLLEIYRSIGEPDSLYGCGGG
KMLQPLTRLQTYEHEAMWGKALVTYDLETTIASSTRHAGIIQALQNLGLCHILSMYLKGL
DHKNKEWSAELQELHYQAAWRNMQWDHCISVNKGIEGTSYHESLYNALQSLRDREFSTFY
ESLKYARVKEVEELCKDSLESVYSLYPTLSRLQAIGELENIGELFSRSVTDRQPSEIYMK
WQKHSQLLKDSDFSFQEPIMTLRTVILEILMEKEMESSQRECFEDILTKHLVELSTLART
FKNTQLPERAIFHIKQCKSASCGVSQWQLEEAQVFWAKKEQSLALSILKQMIKKLDASCT
KNDPNLKLMHTECLRICGTWLAETCLENPAAIMETYLEKAVEVAGNYEGESNDELRNGKM
KAFLSLARFSDTQYQRIENYMKSSEFENKQALLERAKEEVGLLREHKIETNRYTVKVQRE
LELDERALRALKEDRKRFLCKAVENYINCLLSGEGHDLWIFRLCSLWLENSGVSEVSGMM
KRDGMKIPSYKYLPLMYQLAARMGTKMMGGLGFHEVLNNLISRISMDHPYHTLFIILALA
NANKDEFLTKPEAAKRSRITKNAPKQSSQLDEDRMEAAHRIIRTIRSRRPQMVRSVEALC
DAYIMLANLDATHWKTQRKGINIPADQPITKLKNLEDVVIPTMEIKVDPTGEYGNLVTIQ
SFKTEFRLAGGLNLPKIIDCLGSDGKERRQLVKGRDDLRQDAVMQQVFQLCNTLLQRNTE
TRKRELTICTYKVVPLSQRSGVLEWCTGTVPIGEFLVNNENGAHKRYRPKDFSAFQCQKK
MMDVREKSFKEKHETFMNVCENFQPVFRYFCMEKFLDPAIWFEKRLAYTRSVATSSIVGY
ILGLGDRHVQNILINEQSAELVHIDLGVAFEQGKILPTPETVPFRLTRDIVDGMGITGVE
GVFRRCCEKTMEVMRSSQETLLTIVEVLLYDPLFDWTMNPLKALYLQQRSEDETELQSTL
NANDQECKRNLSDTDQSFNKVAERVLMRLQEKLKGVEEGTVLSVGGQVNLLIQQAMDPKN
LSRLFPGWKAWV
NT seq 8860 nt   +upstreamnt  +downstreamnt
gatgcagtctgacttggagagtgttccatatgcacttgaaaagaatgtgtgtctgctgct
gttggaattgttctctgtgtacttcaggctgtatcttaaaccttcacaagacattaatag
agttttagttgctagaataattgaagctgtgaccaaaggaaactgttcacaaactgatgg
attaaattgcagatttttggagtatttttccaaggctattcagcatgcaagacaagaaaa
gagctctccaggtctaaatcatatcttagcagcacttattatcttcctcaagactttggc
tgttaactttcgaattcaagtatgtgaattaggagatgaaattcttcctaccttgcttta
tatttggactcaacacagacttaatgattccttaaaggaagtaattattgaattatttca
actgcaaatttatatccatcatccaaaaggagccaaaacccaaggaaaaggttcttatga
atcaagaaaatggaaaaatatcttatacaacttatatgatatgctggttaatgaaataag
tcatataggaagcagagggaaatactcttcagggtctcgtaatattgctgtcaaagaaaa
cttaattgaattgatggcagatgtttgtcaccaggtttttaatgaagattccagagcttt
ggagatttctctgtcttatactaccacacagagagaatttagtgattacagtgcaccttg
caaaaagaagaaaatagaattaggctgggaagtaataaaagaccaccttcagaagtcaca
gaatgattttgatcttgtgccttggttacagattgcaacccaattaatatcaaaatatcc
tgcaagtttacctagctatgaactgtcaccagtactgatgatactctaccagcttctacc
tcagcagcgacatggtgaacgcacaccatatgtgttacgatgcctcacagaagttgcatt
gtgtcaaggcaagaaatcaaacttagaaagcttacaaaagtcagatttattgaaactctg
gattaaaatttggtctattacatttcgtggtataacttctgaacggatacaagctgaaaa
ctttggcttacttggagccataattcaaggcagtttaattgaggttgataaagaattctg
gaagttatttactgggtcaacctgcagaccttcatgtcctgcagtatgctgtttgactgt
ggcactgaccatctttgtggttccagaaacagtaaacacaggaatggaccaaaatatatg
tgaagtaaatagaagtttttctttaaaggaattgataatgaaatggctcttattctgtca
gttagaggatgactttgaagaaagtacagagcttcctccaattcttcacagtaattttcc
tcatcttgcactggagaaaattctcgtgagtctcactatgaaaaactgtaaagctgcaat
gatttttttccagagtatgccagaatgtgaacaccaccaaaaagatgaagaagagccttc
attcacagaagttgaagaactatttctgcagacaactttagacaatatggattttttaac
aactgtggaagaatgtgctatagaaaagcaccagtccagtcctggcttttctgtccacca
aaatctcaaggtatctctggatcactatcttctgggactagcagaacagcttctaaataa
ctactcacctgagactacaaattcagaaacacttgtccggtgttcaagtcttttggtggg
agttctcagctgctattgttatgtgggtataatagctgaagaagaagcatatgaatcaga
attatttcagaaagccaagtctctaatgcagtgtgcaggagaaattatcactctgtttaa
aaataagacaaatgaggaatctagaattgtttcagtgagaaatatgatgaacctttgtac
aagctgcttgtgtcactgtacccagcacagtccaaataagattgcatctggctttttcct
acgattattaacatcaaagctaatgaatgatattgcagatatttgtagaagtttagcatc
ctttatcaaaaagccatttgagtatggagaaatagagtcagtggaagaagatacagatga
aaatcggatggacatagaggatcagtcatccatgaatctgtttaatgattaccctgttga
tagtgttagtgatgcaaatgaatctggagaaagtcaaggtattattggtgccatgaatcc
tttagctgaagaacatctgtcaaagcaagatctacttttgttagatatgctcaagttctt
gtgtatatgtgtaactactgctcaggccaatactgtgtcattcagagcagctgatattcg
gaggaaattattaatgttaattgattctagtatgctagaccctactaaatctctccactt
acacatgtatctagtgctcttaaaagagcttcctggagaagaatatcctttgccaatgga
agatgttgttgaacttctaaaaccgctatccagtgtgtgttctttgtatcgccgtgacca
ggatgtctgtaaaacaattttaaaccatgttgttcatgtagtgatgaacttatgtccagg
cagtatggaccctgagaacacaagcgatgctcaaggacagtttctaacagtaattggagc
attttggcacttaacaaacgagggaaaatgcatattctctgtaagaatggctctagtaaa
atgtcttaaaactttgcttgaggcagatccttattcaaaatgggctattcttaatgtaat
ggggaaagactttcctgtaaatgaagtatttccacagtttcttgctgataatcatcacca
agttcgtatgttggctgcagtgtcaatcaataggttattccaggatgtgaaacaaagagg
ttcttccacactattgaaagcacttcctttgaagcttcagcaaacggcttttgaaaatgc
atactcaaaagctcaggagggaatgaaagaagtgtcccacagagctgcaaaccctgaact
tttggatgagatttataatagaaagtctgttttactgatgatgatagctgtggttttata
ctgtagccctatctgtgaaaaacaggctttgtttgccctatgcaagtctgtgaaagagaa
tggattagaaccctacctcattaaaaaggttttagaaaaagtttctgaaacctttggata
taggcgtttagaagacttcatggcttctcatttggattatctggttttggagtggctaaa
tcttcaagatagtgaatataacttatcttcttttccttttattttactgaactacacaaa
tgttgaggatttctatagatcttgttataaggttttaattccacatctggtgattagaag
tcattttgatgaagtgaagtccattgctgatcagatacaagaggattggaaaagtctcct
aacagactgctttccaaagattctcgtgaatatcctcccttactttgcctatgaaggtac
aggagacagtggcatggcacagcaaagagagactgctaccaaagtctatgatatgcttaa
agatgaaaacatattaggaaaacagattgatcatttattcattagcaatttaccagagat
cgtggtggagttactgatgacattccatgaaccaggaacttctggtaccagccaaggcac
ttcaggggatttggatcctgctcctaatccacctcattttccgtcacatgtaattaaagc
aacatttgcctacatcagcaattgccataaaaccaaacttaaaagcattttagaaattct
ttccaaaagccctgattcctatcagaaaattcttcttgccatatgtcagcaagcagctga
gacaaacaatatttataaaaagcatagaattttaaaaatatatcacctgtttgttagttt
attactgaaagatataaaaagtggcttagggggagcttgggcctttgttcttcgagatgt
gatttatactttgattcacactatcaacaaaaggccttcccgtttcatggatgtgtcatt
acgtagcttctccctttgttgtgacctgctaagccgggtttgtcacacagcagtaactta
ctgtaaggatgctttagaaaatcatcttcatgttattgttggcacactcatacctctggt
ggatgatcagatggaggttcaggaacaggtattggacttgttgaaatacttggtgataga
taacaaggataatgaaaacctctatatgacgattaaacttttagatccttttcctgacca
tgttgtctttaaggatttgcatattactcagcagaaaatcaaatatagtagaggaccctt
ttcacttttggaggaaattaaccactttctctcagtaagtgtttatggtgcacttccttt
gacaaggcttgaaggactgaaggatcttcgaagacaactagaacaacataaagatcagat
gatggatcttatgagagcatctcaggataacccacaagatggcataatggtgaagctagt
tgtcagcttgttgcagttatccaagatggcaataaaccacactggtgaaagagaagtttt
agaggctgttggaagctgcttgggagaagtgggccctatagatttctctaccatagctat
acaacataatagagataaatcttatattaaggcccttgagttatttgaagataaagaact
tcagtggaccttcataatgctgaactacctaaataatacactagtagaagattgcgtaaa
tgtgcgatcagctgctgttatctgtttgaaaagtattttagctacaaagactggacatca
tttctgggagatttataagacaacaacggatcccatgctcatctatctacaaccttttag
aacatcgagaaaaaagtttttagaagtacccagacttgacagagaaaaccctttagaagg
tttggatgatacaagcctgtggattcctcaaagtgaaaatcatgatgtttggataaagac
actgacttgtgctgttttggatagtggaggcatacaaagtgaaattcttcaattattaaa
gccactgtgtgaagtgaaaagtgacttttgtcagactgtgcttccatacttgattcatga
tattttactccaagatacaaatgactcatggagaaagctactttctacacatattcaggg
atttttcactaactgtttcagacacatctcacaaacgagccaatccatgatccctgcaaa
tttggattcagagtctgagcccttctttcgatgctggaaaaaatcacaaagaacaatgct
tgctgttgtggactacatgaggagacaaaagagaccttctttaggaacagtttatgatga
tgctttctggctggagttgaattacctagaagttgccaaggtagctcagtcttgtgcagc
tcactttacagcattgctctatgcagaaatctatgcagataagaaaagcatggatgatca
agagaaaagcagagacagcagagacaggcgcgggaactggcaagtgcgaagggactttgt
cctcccagctgacatgctcgccactcgccgacgacaactcccatcgctctactactatga
aaaggaagaagaaccttgttcaatccagaatccctcaaactccagaaagaaggctcgctt
gcctggtatcacatcccactattggacgtggaaacctgcctgcacctgcttcattgatct
actcttagaaatctacagaagtataggagagccagatagtctttatggctgtggtggagg
gaaaatgctacaacctcttactagactacaaacatatgaacatgaagcaatgtgggggaa
agccctagtaacgtatgaccttgagacaacaatcgcctcctcaacacgccacgcaggaat
aattcaggccttgcagaatctgggactctgccatattctttctatgtacttaaaaggatt
agatcataaaaataaagagtggtctgctgaactacaggaacttcattaccaagcagcctg
gaggaatatgcagtgggaccactgcatttctgtcaacaaaggaatagaaggaaccagtta
ccacgaatcattgtataatgctctgcagtctctaagagatagagaattctctacatttta
tgagagtctcaagtatgccagagtaaaggaagtggaagagttgtgtaaggacagcctcga
gtctgtgtattctctctaccccacacttagcagattgcaggccattggagagcttgaaaa
cattggggagcttttctcaagatcagtcacagatagacaaccctcagaaatatacatgaa
gtggcaaaaacactcccagcttctcaaagacagtgatttcagttttcaggagcctatcat
gactctgcgcacagtcattctggagatcctgatggaaaaggaaatggagagctctcaacg
agagtgtttcgaggacattcttaccaaacacctcgtagaactctccacactagcccgaac
tttcaaaaacactcagctccctgaaagagcaatatttcacattaaacagtgtaagtcagc
tagttgtggagtctctcagtggcagctggaggaagcgcaagtattttgggcaaaaaagga
gcagagtcttgccctgagtattctcaagcaaatgatcaagaagttggatgccagttgtac
caagaatgatcccaatctaaaacttatgcacacagaatgtctgaggatttgtggcacctg
gttagcagagacttgcttggaaaatcctgcggccatcatggagacttacctagaaaaggc
agtggaagttgctggaaattatgaaggagaaagcaatgatgagctcagaaatggaaaaat
gaaggcatttctctcattagcgcggttctcggatactcagtaccagagaattgaaaacta
catgaaatcatcagaatttgaaaataagcaagctctcctggaaagggccaaagaggaagt
gggccttcttagggaacataaaattgagactaacagatacacggtgaaggttcagcgaga
gctggagctggatgaacgtgcgcttcgtgcacttaaagaggatcgcaaacgtttcttatg
taaagcagttgaaaattacatcaattgtttattaagtggagaaggacatgatctgtggat
attccgtctttgttctctctggcttgaaaattctggagtttctgaagtcagtggtatgat
gaagagagatggaatgaagattccatcatataaatatttgcctcttatgtatcaattggc
tgctagaatgggaaccaaaatgatgggaggcctaggatttcatgaagttcttaataatct
aatctctagaatttctatggatcacccttatcatactttgtttattatactggccttggc
aaatgcaaacaaagatgaatttttgaccaaaccagaggcagcaaaaaggagtagaatcac
caaaaatgcacctaaacaaagctctcagcttgatgaggatcgaatggaggctgcacatag
aataatacgtactatcagaagtaggagacctcagatggtcagaagtgttgaggcactttg
tgatgcttatataatgctagcaaacttagatgccactcattggaagactcagagaaaagg
cataaatattccagcagaccagccaattactaaactgaagaatttagaagatgttgttat
acctactatggaaattaaggtggaccccacaggagaatatggaaatctggtgactataca
atcatttaaaacagaatttcgtttagcaggaggtttaaatttaccaaaaataatagattg
tttggggtctgatggtaaggaaaggagacagcttgtcaagggccgtgatgacctgcgaca
agatgctgtcatgcagcaggttttccagctgtgcaatacactgctgcagaggaacaccga
gaccagaaagagggaactgaccatctgcacgtataaggtggttcccctttctcagcgaag
tggtgttcttgaatggtgcacaggaactgtccctattggggaatttcttgttaacaatga
gaatggtgctcataaaagatacagaccaaaggacttcagtgcctttcaatgccaaaagaa
aatgatggatgtgcgagagaagtcttttaaagagaaacatgaaactttcatgaatgtttg
cgaaaattttcaaccagttttccgttacttctgcatggaaaaattcttggacccagccat
ttggtttgagaaacgattggcttatacacgcagtgtggctacttcttctattgttggtta
catacttggacttggtgatagacatgtgcagaatatcttgataaatgagcagtctgcaga
acttgtgcatatagatttaggagtcgcttttgaacagggtaaaatccttcctactcctga
aacagttccttttaggctcaccagagatatcgtggatgggatgggcattactggtgttga
aggtgtcttcagaaggtgctgtgagaaaactatggaggtcatgagaagctctcaggaaac
cctgttaaccattgtggaggtccttctgtatgatcctctctttgactggaccatgaatcc
tttgaaagctttgtatttacagcagaggtcagaagatgaaactgagctccaatccactct
gaatgcaaatgaccaagaatgcaaacgaaatctcagtgatactgaccagagttttaacaa
ggtagctgagcgtgtcctgatgagactgcaagagaaactgaaaggtgtagaggaaggaac
tgtgctcagtgtgggtggacaggtgaatttgctcatacaacaggccatggaccccaaaaa
tctcagccgacttttcccaggatggaaagcttgggtgtga

DBGET integrated database retrieval system