KEGG   Manis javanica (Malayan pangolin): 108394781
Entry
108394781         CDS       T06054                                 

Gene name
AMHR2
Definition
(RefSeq) anti-Muellerian hormone type-2 receptor
  KO
K04672  anti-mullerian hormone receptor type-2 [EC:2.7.11.30]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    108394781 (AMHR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108394781 (AMHR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mjv01001]
    108394781 (AMHR2)
Enzymes [BR:mjv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     108394781 (AMHR2)
Protein kinases [BR:mjv01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   108394781 (AMHR2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Pkinase_fungal
Other DBs
NCBI-GeneID: 108394781
NCBI-ProteinID: XP_017512052
LinkDB
Position
Unknown
AA seq 490 aa
MQGCRDSDEPGCESPYCDPSPRAHPSPVSTLFTCSCGTDFCNANYSQLPPPGSPGTPGSQ
GPQAVPGESMWMVLALLGLFLLLLLLLGSIILALLPRKAHRVRGGPEPELEPEPEPDLGS
DWSAELPELPELCFSQVIREGGHAVVWTGRLQGELVAIKAFPLRAMAQFQAERALYELPG
LQHDHIVRFITASRGCPGILPCGPLLVLELHPKGSLCHYLTQHTSDWGSSLRMALSLAQG
LAFLHEERWQDGQYKPGIAHRDLSSQNVLIREDGSCAIGDLGLALVLPGLAQPPTWAPTQ
PRGPAAIMEAGTQRYMAPELLDKTLDLQDWGTALRRADVYSLALLLWEILSRCLDLCPDN
RPPPFQMAYEAELGSTPTSCELWTLAVEERRRPYIPSTWCCFTTATIQIPGIKLPPGHSS
QDPGGLRELLEDCWDPDPEARLTAECVQQRLATLAHPQKAHPFPEVCAHSCPPPCPEDCF
STPPCHHSPS
NT seq 1473 nt   +upstreamnt  +downstreamnt
atgcaaggatgccgagacagtgatgagccaggctgtgagtccccctactgtgacccaagc
ccccgagcccaccccagccccgtctccactctcttcacctgctcctgtggcactgacttc
tgcaatgccaattacagccagctgcctcctccggggagccctgggactcctggctcccag
ggtccccaggctgtcccaggcgaatccatgtggatggtgctggcgttgctggggctgttc
cttctcctgcttctgctgctgggcagcatcatcttggccctgctaccacgaaaggcccac
agagtacgaggtgggccagagccagagctagagccagagccagagccagacttaggcagc
gactggagtgcagagctgccagagctgccggagctgtgcttctcccaggtaatccgggaa
ggcggtcacgctgtggtgtggactgggcggctgcaaggcgagctggtagccatcaaggcc
ttccccctgagggctatggcccagttccaagctgagagagccttgtatgagctgccaggc
ctgcagcacgaccacattgtccgctttattactgccagcagggggtgccctggcatcttg
ccctgtgggcctctgttggtactggaactgcaccccaagggctccctatgccactacttg
acccagcacaccagtgactggggaagttccctgcggatggcactgtccctggcacagggt
ctggcatttctccatgaagagcgctggcaagatggccaatataaaccaggtatcgcccac
cgagatctgagtagccagaatgtgctcattcgggaggatggatcatgtgccattggagat
ctgggccttgccttggtgctccctggcctcgctcagccccccacctgggcccctacccaa
ccccgaggcccagctgccatcatggaggccggcacccagaggtacatggcgccagagctc
ttggacaagactctggacctgcaggactggggcacagccctccggcgagctgatgtctac
tctctggctctgctcctgtgggagatcctgagccgctgcctggatttgtgccctgacaac
agaccgccacccttccaaatggcctatgaggcagaactgggtagcactcccaccagctgt
gagctgtggaccttagcagtggaggagagaaggcgcccctacatcccttccacctggtgc
tgctttaccacagcgaccattcagattcctgggatcaagctgcctcctggtcattcttcc
caggaccctggtggcctgagagagctcctagaggactgttgggatccagacccagaagca
cggctgacagctgagtgtgtacagcagcgcctggccacactggcccaccctcagaaggcc
cacccctttccagaggtctgtgcacacagctgcccacctccctgcccagaagactgtttc
tcaactcctccctgccaccattctccctcgtag

DBGET integrated database retrieval system