KEGG   Manis javanica (Malayan pangolin): 108395667
Entry
108395667         CDS       T06054                                 

Gene name
XPA
Definition
(RefSeq) DNA repair protein complementing XP-A cells isoform X1
  KO
K10847  DNA-repair protein complementing XP-A cells
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01524  Platinum drug resistance
mjv03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    108395667 (XPA)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108395667 (XPA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mjv03400]
    108395667 (XPA)
DNA repair and recombination proteins [BR:mjv03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     108395667 (XPA)
SSDB
Motif
Pfam: XPA_C XPA_N zf_C2H2_13 DUF4211 DZR Zn-ribbon_8 zf-dskA_traR
Other DBs
NCBI-GeneID: 108395667
NCBI-ProteinID: XP_017513615
LinkDB
Position
Unknown
AA seq 272 aa
MAAAEASPEPAASEPLAELPASVRASIERKRQRALMLRQARLAAQPYPAMAAAATGGMTN
VKAAPKIIDTGGGFILEEEDEEQRTIGKVVHQPGPVMEFDYAICEECGKEFMDSYLMNHF
DLATCDNCRDADDKHKLITKTEAKQEYLLKDCDLEKREPALKFIVKKNPHHSQWGDMKLY
LKLQIVKRSLEVWGSQEALDEAKEVRQENREKMKQKKFDKKVKELRRAVRSSVWKRETVA
HQHEYGPEENLEDDMYRKICTACGHELTYEKM
NT seq 819 nt   +upstreamnt  +downstreamnt
atggcggcggcggaagcttcgcccgagccggcggcttcggaaccgctggcggagctgcct
gcctcggtgcgggcgagcatcgagcggaagcggcagcgcgcgctgatgctgcgccaggcc
cggctggcggcccaaccctacccggcgatggcggctgcagctaccggaggtatgactaat
gtaaaagcagctccaaagatcattgacacaggaggaggctttattctggaagaggaagat
gaagaacagcgtacaattggaaaagttgttcatcaaccaggacctgttatggaatttgat
tatgcaatatgtgaagaatgtggtaaagaatttatggattcttatcttatgaaccacttt
gatttggcaacttgtgataactgcagagatgctgatgacaaacacaagcttataactaaa
acagaagcaaaacaagaataccttctgaaagactgtgatttagaaaaaagagaaccagct
cttaaatttattgtgaagaagaatcctcatcattcacaatggggtgatatgaagctctac
ttaaaattacagattgtgaagaggtctcttgaagtttggggtagtcaggaagcattagac
gaagcaaaggaagttcgacaggaaaaccgagaaaaaatgaaacagaagaagtttgataaa
aaagtaaaagaattacggcgagcagtgagaagcagtgtgtggaaaagggaaactgttgct
catcagcatgagtatggaccagaagaaaacttagaagatgacatgtaccggaagatctgt
actgcatgtggccatgaattgacatatgagaaaatgtga

DBGET integrated database retrieval system