KEGG   Manis javanica (Malayan pangolin): 108395952
Entry
108395952         CDS       T06054                                 

Gene name
ITPR1
Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 1 isoform X1
  KO
K04958  inositol 1,4,5-triphosphate receptor type 1
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04020  Calcium signaling pathway
mjv04022  cGMP-PKG signaling pathway
mjv04070  Phosphatidylinositol signaling system
mjv04114  Oocyte meiosis
mjv04140  Autophagy - animal
mjv04210  Apoptosis
mjv04218  Cellular senescence
mjv04270  Vascular smooth muscle contraction
mjv04371  Apelin signaling pathway
mjv04540  Gap junction
mjv04611  Platelet activation
mjv04621  NOD-like receptor signaling pathway
mjv04625  C-type lectin receptor signaling pathway
mjv04713  Circadian entrainment
mjv04720  Long-term potentiation
mjv04723  Retrograde endocannabinoid signaling
mjv04724  Glutamatergic synapse
mjv04725  Cholinergic synapse
mjv04726  Serotonergic synapse
mjv04728  Dopaminergic synapse
mjv04730  Long-term depression
mjv04750  Inflammatory mediator regulation of TRP channels
mjv04912  GnRH signaling pathway
mjv04915  Estrogen signaling pathway
mjv04918  Thyroid hormone synthesis
mjv04921  Oxytocin signaling pathway
mjv04922  Glucagon signaling pathway
mjv04924  Renin secretion
mjv04925  Aldosterone synthesis and secretion
mjv04927  Cortisol synthesis and secretion
mjv04928  Parathyroid hormone synthesis, secretion and action
mjv04929  GnRH secretion
mjv04934  Cushing syndrome
mjv04935  Growth hormone synthesis, secretion and action
mjv04970  Salivary secretion
mjv04971  Gastric acid secretion
mjv04972  Pancreatic secretion
mjv05010  Alzheimer disease
mjv05012  Parkinson disease
mjv05016  Huntington disease
mjv05017  Spinocerebellar ataxia
mjv05020  Prion disease
mjv05022  Pathways of neurodegeneration - multiple diseases
mjv05163  Human cytomegalovirus infection
mjv05167  Kaposi sarcoma-associated herpesvirus infection
mjv05170  Human immunodeficiency virus 1 infection
mjv05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    108395952 (ITPR1)
   04020 Calcium signaling pathway
    108395952 (ITPR1)
   04070 Phosphatidylinositol signaling system
    108395952 (ITPR1)
   04022 cGMP-PKG signaling pathway
    108395952 (ITPR1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108395952 (ITPR1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    108395952 (ITPR1)
   04210 Apoptosis
    108395952 (ITPR1)
   04218 Cellular senescence
    108395952 (ITPR1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    108395952 (ITPR1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    108395952 (ITPR1)
   04621 NOD-like receptor signaling pathway
    108395952 (ITPR1)
   04625 C-type lectin receptor signaling pathway
    108395952 (ITPR1)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    108395952 (ITPR1)
   04929 GnRH secretion
    108395952 (ITPR1)
   04912 GnRH signaling pathway
    108395952 (ITPR1)
   04915 Estrogen signaling pathway
    108395952 (ITPR1)
   04921 Oxytocin signaling pathway
    108395952 (ITPR1)
   04935 Growth hormone synthesis, secretion and action
    108395952 (ITPR1)
   04918 Thyroid hormone synthesis
    108395952 (ITPR1)
   04928 Parathyroid hormone synthesis, secretion and action
    108395952 (ITPR1)
   04924 Renin secretion
    108395952 (ITPR1)
   04925 Aldosterone synthesis and secretion
    108395952 (ITPR1)
   04927 Cortisol synthesis and secretion
    108395952 (ITPR1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    108395952 (ITPR1)
  09154 Digestive system
   04970 Salivary secretion
    108395952 (ITPR1)
   04971 Gastric acid secretion
    108395952 (ITPR1)
   04972 Pancreatic secretion
    108395952 (ITPR1)
  09156 Nervous system
   04724 Glutamatergic synapse
    108395952 (ITPR1)
   04725 Cholinergic synapse
    108395952 (ITPR1)
   04728 Dopaminergic synapse
    108395952 (ITPR1)
   04726 Serotonergic synapse
    108395952 (ITPR1)
   04720 Long-term potentiation
    108395952 (ITPR1)
   04730 Long-term depression
    108395952 (ITPR1)
   04723 Retrograde endocannabinoid signaling
    108395952 (ITPR1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    108395952 (ITPR1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    108395952 (ITPR1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    108395952 (ITPR1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108395952 (ITPR1)
   05012 Parkinson disease
    108395952 (ITPR1)
   05016 Huntington disease
    108395952 (ITPR1)
   05017 Spinocerebellar ataxia
    108395952 (ITPR1)
   05020 Prion disease
    108395952 (ITPR1)
   05022 Pathways of neurodegeneration - multiple diseases
    108395952 (ITPR1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    108395952 (ITPR1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108395952 (ITPR1)
   05163 Human cytomegalovirus infection
    108395952 (ITPR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108395952 (ITPR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mjv01009]
    108395952 (ITPR1)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mjv04040]
    108395952 (ITPR1)
Protein phosphatases and associated proteins [BR:mjv01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     108395952 (ITPR1)
Ion channels [BR:mjv04040]
 Ligand-gated channels
  IP3 receptor
   108395952 (ITPR1)
SSDB
Motif
Pfam: Ins145_P3_rec RYDR_ITPR MIR RIH_assoc Ion_trans
Other DBs
NCBI-GeneID: 108395952
NCBI-ProteinID: XP_017514082
LinkDB
Position
Unknown
AA seq 2749 aa
MSDKMSSFLHIGDICSLYAEGSTNGFISTLGLVDDRCVVQPEAGDLNNPPKKFRDCLFKL
CPMNRYSAQKQFWKAAKPGANSTTDAVLLNKLHHAADLEKKQNETENRKLLGTVIQYGNV
IQLLHLKSNKYLTVNKRLPALLEKNAMRVTLDEAGNEGSWFYIQPFYKLRSIGDSVVIGD
KVVLNPVNAGQPLHASSHQLVDNPGCNEVNSVNCNTSWKIVLFMKWSDNKDDILKGGDVV
RLFHAEQEKFLTCDEHRKKQHVFLRTTGRQSATSATSSKALWEVEVVQHDPCRGGAGYWN
SLFRFKHLATGHYLAAEVDPDFEEECLEYQLSVDPDQDASRSRLRNAQEKMVYSLVSVPE
GSDISSIFELDPTTLRGGDSLVPRNSYVRLRHLCTNTWVHSTNIPIDKEEEKPVMLKIGT
SPVKEDKEAFAIVPVSPAEVRDLDFANDASKVLGSIAGKLEKGTITQNERRSVTKLLEDL
VYFVTGGTNSGQDVLEVVFSKPNRERQKLMREQNILKQIFKLLQAPFTDCGDGPMLRLEE
LGDQRHAPFRHICRLCYRVLRHSQQDYRKNQEYIAKQFGFMQKQIGYDVLAEDTITALLH
NNRKLLEKHITAAEIDTFVSLVRKNREPRFLDYLSDLCVSMNKSIPVTQELICKAVLNPT
NADILIETKLVLSRFEFEGVSTGENALEAGEDEEEVWLFWRDSNKEIRSKSVRELAQDAK
EGQKEDRDVLSYYRYQLNLFARMCLDRQYLAINEISGQLDVDLILRCMSDENLPYDLRAS
FCRLMLHMHVDRDPQEQVTPVKYARLWSEIPSEIAIDDYDSSGTSKDEIKERFAQTMEFV
EEYLRDVVCQRFPFSDKEKNKLTFEVVNLARNLIYFGFYNFSDLLRLTKILLAILDCVHV
TTIFPISKMTKGEENKGSNVMRSIHGVGELMTQVVLRGGGFLPVTPMAAAPEGNVKQAEP
EKEDIMVMDTKLKIIEILQFILNVRLDYRISCLLCIFKREFDESNSQASETSSGSSSQEG
PSNVPGALDFEHIEEQAEGIFGGSEENTPLDLDDHGGRTFLRVLLHLTMHDYPPLVSGAL
QLLFRHFSQRQEVLQAFKQVQLLVTSQDVDNYKQIKQDLDQLRSIVEKSELWVYKGQGPD
EAMDGASGENEHKKTEEGNNKPQKHESTSSYNYRVVKEILIRLSRLCVQEGAPVRKSRKQ
QQRLLRNMGAHAVVLELLQIPYEKAEDTKMQEIMRLAHEFLQNFCAGNQQNQALLHKHIN
LFLNPGILEAVTMQHIFMNNFQLCSEINERVVQHFVHCIETHGRNVQYIKFLQTIVKAEG
KFIKKCQDMVMAELVNSGEDVLVFYNDRASFQTLIQMMRSERDRMDENSPLMYHIHLVEL
LAVCTEGKNVYTEIKCNSLLPLDDIVRVVTHEDCIPEVKIAYINFLNHCYVDTEVEMKEI
YTSNHMWKLFENFLVDICRACNNTSDRKHADSVLEKYVTEIVMSIVTTFFSSPFSDQSTT
LQTRQPVFVQLLQGVFRVYHCNWLMPNQKASVESCIRVLSDVAKSRAIAIPVDLDSQVNN
LFLKSHNIVQKTAMNWRLTARNAARRDSVLAASRDYRNIIERLQDIVSALEDRLRPLVQA
ELSVLVDVLHRPELLFPENTDARRKCESGGFICKLIKHTKQLLEENEEKLCIKVLQTLRE
MMTKDRGYGEKLISIDELDNAELPQAPDAENSTEQELEPSPPLRQLEDHKRGEALRQILV
NRYYGNVRPSGRRESLTSFGNGPLSPGGPSKPGGGGGGSGSSSMSRGEMSLAEVQCHLDK
EGASNLVIDLIMNASSDRVFHESILLAIALLEGGNTTIQHSFFCRLTEDKKSEKFFKVFY
DRMKVAQQEIKATVTVNTSDLGNKKKDDETDRDAPSRKKAKEPTTQITEEVRDQLLEASA
ATRKAFTTFRREADPDDHYQSGEGAQATADKTKDDLEMSAVITIMQPILRFLQLLCENHN
RDLQNFLRCQNNKTNYNLVCETLQFLDCICGSTTGGLGLLGLYINEKNVALINQTLESLT
EYCQGPCHENQNCIATHESNGIDIITALILNDINPLGKKRMDLVLELKNNASKLLLAIME
SRHDSENAERILYNMRPKELVEVIKKAYMQGEVEFEDGENGEEGAASPRNVGHNIYILAH
QLARHNKELQTMLKPGGQVDGDEALEFYAKHTAQIEIVRLDRTMEQIVFPVPSICEFLTK
ESKLRIYYTTERDEQGSKINDFFLRSEDLFNEMNWQKKLRAQPVLYWCARNMSVWSSISF
NLAVLMNLLVAFFYPFKGVRGGTLEPHWSGLLWTAMLISLAIVIALPKPHGIRALIASTI
LRLIFSVGLQPTLFLLGAFNVCNKIIFLMSFVGNCGTFTRGYRAMVLDVEFLYHLLYLLI
CAMGLFVHEFFYSLLLFDLVYREETLLNVIKSVTRNGRSIILTAVLALILVYLFSIVGYL
FFKDDFILEVDRLPNETALPEASESLASEFLYSDVCRLESGENCSSPAPREGLVRAEETE
QDKEHTCETLLMCIVTVLSHGLRSGGGVGDVLRKPSKEEPLFAARVIYDLLFFFMVIIIV
LNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVTFEEHIKEEHNMWHY
LCFIVLVKVKDSTEYTGPESYVAEMIKERNLDWFPRMRAMSLVSSDSEGEQNELRNLQEK
LESTMKLVTNLSGQLSELKDQMTEQRKQKQRIGLLGHPPHMNVNPQQPA
NT seq 8250 nt   +upstreamnt  +downstreamnt
atgtctgacaaaatgtctagtttcctgcatattggagacatctgttctctgtacgcggaa
ggatcgacaaatggatttattagcaccttgggcctggttgatgatcgttgtgttgtacag
ccagaagctggggaccttaacaatccacccaagaaattcagagattgcctctttaaacta
tgtcctatgaatcgctactctgcccagaagcagttctggaaagcggctaagccaggggcc
aacagtacaacagatgcggttctgctcaacaaactgcatcatgctgccgacttggaaaag
aagcagaatgagacagaaaacaggaaattgctggggactgtaatccagtacggcaatgtg
atccagctcctgcatttgaaaagtaataaatacctaactgtgaataagaggctgccggct
ctgcttgagaagaatgccatgagagtgacgctggacgaggccgggaatgaagggtcctgg
ttttacattcagccgttctacaagctgcggtccatcggggacagcgtggtcataggtgac
aaagttgttctgaatcccgtcaatgctggccagcccctacacgccagcagccatcagctg
gtggataaccctggctgcaatgaggtcaattccgtcaactgcaatacaagctggaaaata
gtccttttcatgaaatggagtgataacaaagacgacatattaaaggggggggacgtggtg
aggctgtttcatgccgagcaggagaaatttctcacctgtgatgagcaccggaagaagcag
catgtgttcctgagaactaccggccggcagtcggccacgtctgccaccagttcgaaagcc
ctgtgggaggtggaggtggtccagcatgacccgtgtcggggtggagcagggtattggaac
agcctcttccgtttcaagcatcttgctaccgggcactacttagcagcagaggtagaccct
gactttgaggaagaatgcctggagtatcagctgtcagtggatcctgatcaggacgcctct
cgaagcaggttgcgaaatgcccaagaaaagatggtgtactcgctggtgtccgtgcccgaa
ggcagcgacatctcctccatttttgaacttgaccccaccactctccgtgggggggatagc
ctcgtccccagaaactcctacgtccggctcagacacctatgtactaatacctgggttcac
agcacaaatatccccattgacaaggaggaagagaaacccgtgatgctgaaaattggcacc
tctcctgtgaaggaggataaggaagcatttgccatagttccagtatctcctgctgaggtt
cgggacctggattttgccaatgatgctagcaaggtgctgggctccatagctgggaagctg
gagaagggcaccatcacccagaatgaaagaaggtctgtaaccaagctgctggaagatttg
gtttattttgtcactggtggaacgaactctggtcaggatgtgcttgaagtcgtcttctcc
aagcccaacagagaaaggcagaagctgatgagggaacagaatatcctcaagcagatcttc
aagttgttacaggcgccattcacagactgtggcgatggcccgatgctgcgactggaagag
cttggggaccagagacacgcccctttcagacacatctgccggctctgctacagggtcctg
aggcactcccagcaggactacaggaagaaccaggaatacatagccaagcagtttggcttc
atgcagaagcagattggctatgacgtgttggctgaagacactattaccgccctgctccac
aataatcgaaaactcctggaaaaacacatcactgccgccgagatcgacacattcgtcagt
ctggtgcgaaagaacagggagcccaggttcttagattacctctctgacctctgtgtgtcc
atgaacaaatcaattccagtgacccaagaactgatatgtaaagctgtgctgaatccgact
aacgccgatatcctgattgagaccaagctggttctttctcgttttgaatttgaaggtgtt
tctactggagagaatgctctagaggcaggagaagatgaggaggaggtgtggctgttctgg
agggacagcaacaaagagatccgcagtaagagtgtccgggagctggctcaggatgctaag
gaagggcagaaggaggaccgggatgtgctcagctactacaggtatcagctgaaccttttt
gctaggatgtgtctagaccgccagtatctggccatcaacgaaatatcaggccagctggat
gtagatctcattctccgctgcatgtctgacgagaacctgccctacgacctgagggcatcc
ttctgccgcctcatgcttcatatgcatgtggaccgagatccccaggaacaagtcacgccc
gtgaaatatgctcgcctctggtccgagattccctccgagatcgccattgatgactatgat
agtagtgggacctccaaagatgaaattaaggagaggtttgctcagaccatggaatttgtg
gaggaatatttacgagacgtggtttgtcagagatttcctttctctgataaggagaaaaat
aagcttacatttgaggtcgtaaatttagctaggaatctcatatactttggtttctacaac
ttctctgaccttctccgcttaaccaaaatcctcttggctatactcgactgtgtgcacgtg
acgacaatcttccccattagcaaaatgacgaaaggagaagagaataaaggcagtaatgtg
atgcggtccatccacggcgtcggagagctgatgacacaggtggtgctccgggggggcggc
tttttgcccgtgacgcccatggctgctgcccctgaaggcaatgtgaagcaggcagaacca
gagaaggaggacatcatggtcatggacaccaagctgaagatcatcgaaatactccagttt
attctgaatgtgaggttggattataggatctcctgcctcctatgtatatttaagcgggag
tttgatgaaagcaattcccaggcttcggaaacatcctccggaagcagcagccaagagggg
ccaagtaatgtaccaggtgctcttgactttgaacacattgaggagcaagcagaaggcatc
tttggaggaagtgaggagaacaccccgctggacctggatgatcatggcggccgaaccttc
ctccgcgtcttgctccacttgacgatgcacgactatcctcccctcgtgtcgggggccctg
cagctcctctttcggcacttcagtcagaggcaggaggtcctgcaggccttcaagcaggtt
caactgcttgttaccagccaagatgttgacaactacaaacagatcaaacaagacttggat
caactgagatccattgtggaaaagtcagagctctgggtgtacaaagggcagggccccgac
gaggccatggatggtgcatctggtgaaaatgaacacaagaaaacagaggaggggaataac
aagccacaaaagcacgagagcaccagcagctacaactacagggtggtgaaagagatcctg
atccggctcagcaggctatgcgtgcaggagggcgcgcctgtgaggaagagcaggaaacag
cagcagcgcctgctccggaacatgggtgcacacgccgtcgtgctagagctcctgcagatt
ccctacgagaaggctgaagataccaagatgcaggagataatgaggctcgctcatgaattt
ctgcagaacttctgcgcaggcaatcagcagaatcaagccttgctacacaaacacataaac
ctgtttctcaacccagggatcctggaggctgtaacgatgcagcacatcttcatgaacaat
ttccagctctgcagtgagatcaacgagagagtcgtccagcactttgttcactgcattgag
actcatggtcgaaacgtccagtacataaaattcttgcagacgattgtcaaggcagaaggg
aaattcattaaaaagtgccaagacatggtcatggctgagctggttaattcaggagaggac
gtcctcgtgttctacaatgacagagcctctttccagactctgatccagatgatgaggtca
gagcgggaccggatggatgagaacagccctctcatgtaccacatccacctggtggagctc
ttggccgtgtgcacagagggcaagaatgtctacacggagatcaagtgcaactccttgctc
cctctggacgacattgtccgcgtggtgacccatgaggactgcatcccagaggttaagatt
gcatacatcaacttcctaaatcactgctatgtggatactgaggtggaaatgaaggagatt
tacaccagcaatcacatgtggaaactgtttgagaatttccttgtggacatctgcagggcc
tgcaacaacacaagtgacaggaaacacgcagactccgtcttggagaagtatgtcaccgag
attgtcatgagcatcgtcacgaccttcttcagctctcccttctcggaccagagtacaacg
ctgcagactcgccagcctgtctttgtgcaactgttgcaaggtgtgttccgggtttaccac
tgcaactggttgatgccgaaccaaaaggcctccgtggagagctgcatccgggtgctctct
gatgtagccaagagccgggccattgccattcctgtggacctggacagccaagtcaacaac
ctctttctgaagtcccataacattgtacagaaaaccgccatgaactggcggctgacagcc
cgcaatgcggctcgtagagactctgttctggcagcttccagagactaccggaatatcatc
gagagattacaggacatcgtctcggcgctggaggaccgcctgcggcccctggtacaggcc
gagctctccgtgctcgtggatgtgctccacagacccgagttgcttttcccagagaacaca
gatgccaggagaaagtgtgaaagtgggggcttcatttgcaagttaataaaacatactaaa
cagctgctggaggaaaatgaggagaaactctgcattaaggtcctacaaaccctcagagaa
atgatgaccaaagatagaggctatggagaaaagctaatttccattgatgaattggataat
gctgagctgccgcaagctccggatgctgagaactccacagagcaggagcttgaaccgagt
ccacccctgaggcaactggaagaccataaaaggggtgaggccctcaggcaaattttggtc
aaccgctactatggaaatgtccgaccttcaggaagaagggagagccttaccagcttcggc
aatggacccctgtcacctggaggacccagcaagcctgggggaggagggggaggttctggg
tccagctccatgagcaggggcgagatgagcctggctgaggttcagtgccacctcgacaag
gagggcgcctccaacctggtcatcgacctcataatgaatgcatccagtgaccgagtgttc
cacgaaagcattctcctggctatcgcccttctggaaggaggcaacaccaccattcagcac
tcctttttctgccggttgacagaagataagaagtcagagaagttctttaaagtcttctat
gaccgaatgaaggtggcccagcaagaaatcaaggcaacggtgacagtgaacaccagtgac
ttgggaaataaaaagaaagatgatgagacagacagggatgccccatcaaggaaaaaagcc
aaggagcccaccactcaaataacggaagaggtccgcgatcagctcctggaggcctcggcc
gccaccaggaaggccttcaccacctttaggagggaggctgaccccgacgaccactaccag
tctggggagggtgcacaggccactgcggacaagaccaaggatgacctggagatgagcgcc
gtcatcaccatcatgcagcccatcctccgcttcctgcagctgctgtgcgaaaaccacaac
cgggacctgcagaacttccttcgttgccaaaataacaagaccaactacaatttggtatgt
gagacgctgcagtttctggactgtatctgcggaagcacaactggcggtcttggtcttctc
ggactctatataaacgaaaagaacgtagccctcatcaaccaaactctggagagtctgacc
gagtactgccagggtccttgccatgagaaccagaactgcatcgccacccacgagtccaat
ggcattgacatcatcacagccctgatcctgaatgacatcaatcctttaggaaagaagaga
atggatctggtactagaactgaagaacaatgcttcaaagttgctgctggccatcatggag
agcaggcacgacagtgaaaatgcagagaggatactttacaacatgaggccaaaggaactg
gtggaagtgatcaagaaagcctatatgcaaggggaagtggaatttgaggatggggagaat
ggtgaggaaggagccgcctcgcctaggaacgtggggcataacatctacatactagctcac
cagttggctcggcacaacaaagagctgcagactatgctaaaacctggtggccaggtggat
ggagatgaagctctggagttttatgccaagcacacggcccagatagagattgtccggtta
gaccggaccatggaacagatcgttttccctgtgcccagcatatgtgaattcctaaccaag
gagtcaaaactgcggatatactacacaacggagcgggatgagcaaggcagcaagattaac
gacttcttcctgcgctccgaagacctcttcaacgagatgaactggcaaaagaaactgaga
gcccagcctgttctgtactggtgcgcccgcaacatgtctgtgtggagcagcatctccttc
aacctggccgtcctgatgaacctgcttgtggcgtttttctacccatttaaaggagtccga
ggaggaaccttggagccacactggtcggggctgctgtggacagctatgctcatctctctg
gccatcgtcattgcactccccaagccccacggcatccgggccttaattgcttccacgatt
ctacggttgatattttccgttgggctacaacccacattgtttcttctgggggctttcaat
gtctgcaataaaatcatctttctaatgagcttcgtgggcaactgtggaacattcaccaga
ggctaccgggccatggttcttgatgttgagttcctctatcatttgttgtatctgctgatc
tgtgccatggggctctttgtccacgaattcttctacagcctgctgctttttgatttagtg
tacagagaagagactctgcttaatgtcattaaaagtgtcactcgcaatggacggtccatc
atcttgacagcagttctggctttgatcctggtttacctgttctcaatagtgggctatctc
ttcttcaaggatgactttatcttggaagtagataggttgcccaatgaaacagctctccca
gaagccagcgagagtttggcaagcgagtttctgtactctgacgtgtgtcggttggagagt
ggagagaactgctcctctcctgcccccagagaaggcctggttcgtgcagaagagacggag
caagataaggagcacacgtgtgagacactgctgatgtgcatcgtcacggtgctgagtcac
gggctgagaagcgggggcggcgtcggagatgtgctcaggaagccgtccaaagaggagccc
ctgttcgccgccagagtcatctatgacctcctgttcttcttcatggtcatcatcatcgtc
ctcaacctcattttcggggtcatcattgacaccttcgcggacctgcggagtgagaagcag
aagaaagaggagatcttaaagaccacgtgcttcatctgcggcttggaaagagacaagttt
gacaacaagactgtcacctttgaagagcacatcaaggaggagcataacatgtggcactat
ctgtgcttcatcgtcctggtgaaagtgaaggactccacggagtacactgggcccgagagc
tatgtagcagaaatgatcaaggaaagaaaccttgactggttcccaaggatgagagccatg
tccttggtcagcagtgactctgaaggagaacagaatgagctgaggaacctgcaggagaag
ctggagtccaccatgaagcttgtcactaatctttccgggcagctgtcagaattaaaagac
cagatgacagaacaaaggaagcagaaacaaagaattggtcttctaggacatcctcctcac
atgaatgtcaacccacagcaaccagcataa

KEGG   Manis javanica (Malayan pangolin): 108402938
Entry
108402938         CDS       T06054                                 

Gene name
ITPR3
Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 3 isoform X1
  KO
K04960  inositol 1,4,5-triphosphate receptor type 3
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04020  Calcium signaling pathway
mjv04022  cGMP-PKG signaling pathway
mjv04070  Phosphatidylinositol signaling system
mjv04114  Oocyte meiosis
mjv04210  Apoptosis
mjv04218  Cellular senescence
mjv04270  Vascular smooth muscle contraction
mjv04371  Apelin signaling pathway
mjv04540  Gap junction
mjv04611  Platelet activation
mjv04621  NOD-like receptor signaling pathway
mjv04625  C-type lectin receptor signaling pathway
mjv04713  Circadian entrainment
mjv04720  Long-term potentiation
mjv04723  Retrograde endocannabinoid signaling
mjv04724  Glutamatergic synapse
mjv04725  Cholinergic synapse
mjv04726  Serotonergic synapse
mjv04728  Dopaminergic synapse
mjv04730  Long-term depression
mjv04742  Taste transduction
mjv04750  Inflammatory mediator regulation of TRP channels
mjv04911  Insulin secretion
mjv04912  GnRH signaling pathway
mjv04915  Estrogen signaling pathway
mjv04918  Thyroid hormone synthesis
mjv04921  Oxytocin signaling pathway
mjv04922  Glucagon signaling pathway
mjv04924  Renin secretion
mjv04925  Aldosterone synthesis and secretion
mjv04927  Cortisol synthesis and secretion
mjv04928  Parathyroid hormone synthesis, secretion and action
mjv04929  GnRH secretion
mjv04934  Cushing syndrome
mjv04935  Growth hormone synthesis, secretion and action
mjv04970  Salivary secretion
mjv04971  Gastric acid secretion
mjv04972  Pancreatic secretion
mjv05010  Alzheimer disease
mjv05012  Parkinson disease
mjv05014  Amyotrophic lateral sclerosis
mjv05017  Spinocerebellar ataxia
mjv05020  Prion disease
mjv05022  Pathways of neurodegeneration - multiple diseases
mjv05163  Human cytomegalovirus infection
mjv05167  Kaposi sarcoma-associated herpesvirus infection
mjv05170  Human immunodeficiency virus 1 infection
mjv05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    108402938 (ITPR3)
   04020 Calcium signaling pathway
    108402938 (ITPR3)
   04070 Phosphatidylinositol signaling system
    108402938 (ITPR3)
   04022 cGMP-PKG signaling pathway
    108402938 (ITPR3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    108402938 (ITPR3)
   04210 Apoptosis
    108402938 (ITPR3)
   04218 Cellular senescence
    108402938 (ITPR3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    108402938 (ITPR3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    108402938 (ITPR3)
   04621 NOD-like receptor signaling pathway
    108402938 (ITPR3)
   04625 C-type lectin receptor signaling pathway
    108402938 (ITPR3)
  09152 Endocrine system
   04911 Insulin secretion
    108402938 (ITPR3)
   04922 Glucagon signaling pathway
    108402938 (ITPR3)
   04929 GnRH secretion
    108402938 (ITPR3)
   04912 GnRH signaling pathway
    108402938 (ITPR3)
   04915 Estrogen signaling pathway
    108402938 (ITPR3)
   04921 Oxytocin signaling pathway
    108402938 (ITPR3)
   04935 Growth hormone synthesis, secretion and action
    108402938 (ITPR3)
   04918 Thyroid hormone synthesis
    108402938 (ITPR3)
   04928 Parathyroid hormone synthesis, secretion and action
    108402938 (ITPR3)
   04924 Renin secretion
    108402938 (ITPR3)
   04925 Aldosterone synthesis and secretion
    108402938 (ITPR3)
   04927 Cortisol synthesis and secretion
    108402938 (ITPR3)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    108402938 (ITPR3)
  09154 Digestive system
   04970 Salivary secretion
    108402938 (ITPR3)
   04971 Gastric acid secretion
    108402938 (ITPR3)
   04972 Pancreatic secretion
    108402938 (ITPR3)
  09156 Nervous system
   04724 Glutamatergic synapse
    108402938 (ITPR3)
   04725 Cholinergic synapse
    108402938 (ITPR3)
   04728 Dopaminergic synapse
    108402938 (ITPR3)
   04726 Serotonergic synapse
    108402938 (ITPR3)
   04720 Long-term potentiation
    108402938 (ITPR3)
   04730 Long-term depression
    108402938 (ITPR3)
   04723 Retrograde endocannabinoid signaling
    108402938 (ITPR3)
  09157 Sensory system
   04742 Taste transduction
    108402938 (ITPR3)
   04750 Inflammatory mediator regulation of TRP channels
    108402938 (ITPR3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    108402938 (ITPR3)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    108402938 (ITPR3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108402938 (ITPR3)
   05012 Parkinson disease
    108402938 (ITPR3)
   05014 Amyotrophic lateral sclerosis
    108402938 (ITPR3)
   05017 Spinocerebellar ataxia
    108402938 (ITPR3)
   05020 Prion disease
    108402938 (ITPR3)
   05022 Pathways of neurodegeneration - multiple diseases
    108402938 (ITPR3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    108402938 (ITPR3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108402938 (ITPR3)
   05163 Human cytomegalovirus infection
    108402938 (ITPR3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108402938 (ITPR3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mjv01009]
    108402938 (ITPR3)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mjv04040]
    108402938 (ITPR3)
Protein phosphatases and associated proteins [BR:mjv01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     108402938 (ITPR3)
Ion channels [BR:mjv04040]
 Ligand-gated channels
  IP3 receptor
   108402938 (ITPR3)
SSDB
Motif
Pfam: Ins145_P3_rec RYDR_ITPR MIR RIH_assoc Ion_trans PknG_TPR
Other DBs
NCBI-GeneID: 108402938
NCBI-ProteinID: XP_017525278
LinkDB
Position
Unknown
AA seq 2672 aa
MSEMSSFLHIGDIVSLYAEGSVNGFISTLGLVDDRCVVEPAAGDLDNPPKKFRDCLFKVC
PMNRYSAQKQYWKAKQTKQDKEKIADVVLLQKLQHAAQMEQKQNDTENKKVHGDVVKYGS
VIQLLHMKSNKYLTVNKRLPALLEKNAMRVTLDAMGNEGSWLFIQPFWKLRSNGDNVVVG
DKVILNPVNAGQPLHASSYELSDNAGCKEVNSVNCNTSWKINLFMQFRDHLEEVLKGGDV
VRLFHAEQEKFLTCDEYKGKLQVFLRTTLRQSATSATSSNALWEVEVVHHDPCRGGAGHW
NGLYRFKHLATGNYLAAEENPSYKGDASDPKAAGTGVQGRTGRRNAGEKIKYRLVAVPHG
NDIASLFELDPTTLQKTDSFVPRNSYVRLRHLCTNTWIQSTNVPIDIEEERPIRLMLGTC
PTKEDKEAFAIVSVPVSEIRDLDFANDASSMLASAVEKLNEGFISQNDRRFVIQLLEDLV
FFVSDVPNNGQNVLDIMVTKANRERQKLMREQNILRQIFGILKVPFRDKAGEGPLVRLEE
LSDQKNAPYQHMFRLCYRVLRHSQEDYRKNQEHIAKQFGMMQSQIGYDILAEDTITALLH
NNRKLLEKHITKTEVETFVSLVRKNREPRFLDYLSDLCVSNHIAIPVTQELICKCVLDPK
NSDILIQTELRPVKEMAQSHEYLSIEYSEEEVWLTWTDRNNEHHEKSVRQLAQEARAGNA
HDENVLSYYRYQLKLFARMCLDRQYLAIDEISQQLGVDLIFLCMADEMLPFDLRASFCHL
MLHVHVDRDPQELVTPVKFARLWTEIPTAITIKDYDSNLNTSRDDKKNKFASTMEFVEDY
LNNVVGEAVPFANEEKNKLTFEVVSLAHNLIYFGFYSFSELLRLTRTLLGIIDCVQGPPA
LLQAYEDSGGKNVRRSIQGVGHMMSTMVLSRKQSVFGTPSLSASAGAPEPLDRSKFEENE
DIVVMETKLKILEILQFILNVRLDYRISYLLSVFKKEFVEVFPMQDSGADGTAPAFDSTT
ATMNLDRIGEQAEAMFGVGKTSSMLEVDDEGGRMFLRVLIHLTMHDYAPLVSGALQLLFK
HFSQRQEAMHTFKQVQLLISAQDVENYKVIKSELDRLRTMVEKSELWVDKKGSGKGEEVE
AGAAKDKKEQPTDEEGFLHLPGEKSSENYQIIKGILERLNKMCGVGEQMRKKQQRLLKNM
DAHKVMLDLLQIPYDKGDAKMMEILRYTHQFLQKFCAGNPGNQALLHKHLHLFLTPGLLE
AETMQHIFLNNYQLCSEMGEPVLQHFVHLLATHGRHVQYLDFLHTVIKAEGKYVKKCQDM
IMTELTNAGDDVVVFYNDKASLANLLDMMKTARDGVEDHSPLMYHISLVDLLAACAEGKN
VYTEIKCTSLLPLEDVVSVVTHEDCITEVKMAYVNFVNHCYVDTEVEMKEIYTSNHIWTL
FENFTLDIARVCSKREKRLADPTLEKYVLTVVLDTISAFFSSPFSENSTSLQTHQTIVVQ
LLQSTTRLLECPWLQQQLRGSVEACIRTLAMVAKSRAISLPMDLDAHISSLLSSGASCAA
AAQRNASSYKAAMRAFPRVIPTANQWDYKNIIEKLQDIITALEERLKPLVQAELSVLVDV
LHWPELLFLEGSEAYQRCESGGFLSKLIQHTKDLMESEEKLCVKVLRTLQQMLLKKTKYG
DRGNQLRKMLLQNYLQNRKSSSRGDLPDPMGTGLDQDWSAIAATQCRLDKEGATKLVCDL
ITSTKNEKIFQESIGLAIRLLDGGNTEIQKSFYNLMMSDKKSERFFKVLHDRMKRAQQET
KSTVAVNMNDLGSQPQEDREPADSTTKGRVASFSMPGSSSRNYLLGPSLRRGHEVGERVQ
SSEMGTSVLIMQPILRFLQLLCENHNRDLQNFLRCQNNKTNYNLVCETLQFLDIMCGSTT
GGLGLLGLYINEDNVGLVIQTLETLTEYCQGPCHENQSCIVTHESNGIDIITALILNDIS
PLCKYRMDLVLQLKDNASKLLLALMESRHDSENAERILISLRPQELVDVIKKAYVQEEER
ENSEVSPREVGHNIYILALQLSRHNKQLQHLLKPVKRIQEEEAEGLSSMLSLNNKQLSQM
LKSSAPAQEEEEDPLAYYENHTSQIEIVRQDRSMEQIVFPVPGICQFLTEETKHRLFTTT
EQDEQGSKVSDFFDQSSFLHNEMEWQRKLRSMPLIYWFSRRMTLWGSISFNLAVFINIII
AFFYPYMEGASTGVLGSPLISLLFWILICFSIAALFTKHYSVRPLIVALILRSIYYLGIG
PTLNILGALNLTNKIVFVVSFVGNRGTFIRGYKAMIMDMEFLYHVGYILTSVLGLFAHEL
FYSILLFDLIYREETLFNVIKSVTRNGRSILLTALLALILVYLFSIVGFLFLKDDFILEV
DRLPSNHSRANPLGMPHGAATFMGTCSGDNIDCVSGVSVPEVLEEDKEPDSTERACDTLL
MCIVTVMNHGLRNGGGVGDILRKPSKDESLFPARVVYDLLFFFIVIIIVLNLIFGVIIDT
FADLRSEKQKKEEVLKTTCFICGLERDKFDNKTVSFEEHIKFEHNMWNYLYFIVLVRVKN
KTDYTGPESYVAQMIKNKNLDWFPRMRAMSLVSNEGEGEQNEIRILQDKLNSTMKLVSHL
TAQLNELKEQMTEQRKRRQRLGFVDVQNCMSR
NT seq 8019 nt   +upstreamnt  +downstreamnt
atgagcgagatgtccagctttctccacatcggagatatcgtctccctgtacgccgagggc
tccgtcaatggcttcatcagcactttggggttggtggatgaccgctgtgtggtggagcct
gcggcaggggacctggacaacccccctaagaagtttcgagactgcctgttcaaggtgtgt
cccatgaaccgctattcagcccagaagcagtactggaaggccaagcagaccaagcaggac
aaggagaagattgctgacgtagtgctgctgcagaagctgcagcacgcagcccagatggag
cagaagcagaatgacacggagaacaaaaaagtgcatggggacgtggtgaagtacggcagt
gtgatccagctcctacacatgaagagcaataagtacctgacagtgaacaagcgcctgccg
gcgctgctggagaagaacgccatgcgggtgacactggatgccatgggcaatgagggctcc
tggctcttcatacagcctttctggaagctgcggagcaatggggacaatgtggtggtgggg
gacaaggtgatactgaatcctgtcaatgcaggacagcctctgcatgccagcagttatgag
ctcagcgacaacgccggctgcaaggaggtcaactctgtgaactgcaatactagctggaag
attaacctgtttatgcagttccgagaccacctggaggaggtgttgaaagggggagatgtg
gtgcggctgttccacgcagagcaggagaagttcctgacatgtgacgagtacaagggcaag
ctgcaagtgttcctgcgcaccacgctgcgccagtctgccacctcagccaccagctccaac
gccctctgggaggttgaggtggtccaccacgacccctgccgtggaggagctggccactgg
aatggcctgtaccgcttcaagcacctggccacgggcaactacctggctgctgaggagaac
cccagttacaagggtgatgcatcggaccccaaggcagcaggaacgggtgtccagggccgc
acaggtcgccggaatgctggggagaagataaagtaccgcctggtggctgtgccccatggc
aatgacatcgcctccctctttgagctggaccccaccacattgcagaaaactgactccttc
gtgccacggaactcatatgtccggctgcgacatctctgcaccaacacgtggatccagagc
accaacgtgcccattgacattgaggaggagcggcccattcggctcatgctgggtacctgc
cccaccaaggaggacaaggaggcctttgccatcgtgtcggttcctgtgtccgagatccga
gacctggactttgccaatgatgccagctccatgctagccagcgctgtggagaaactcaat
gaaggttttatcagccagaacgaccgcaggtttgtcatccagctgctggaggacctggtg
ttcttcgtcagcgacgtccccaacaatgggcagaacgtgctggacatcatggtcaccaag
gccaaccgggaacggcagaagctgatgagggagcagaacattctcagacagatctttggc
attctgaaagtcccgttccgtgacaaggcgggtgagggccctctggtgcggctggaggag
ctgtcggaccagaagaatgccccctaccagcacatgttccgcctgtgctaccgcgtgctg
cgccactctcaggaggactaccgcaagaatcaggagcacatcgccaagcagtttgggatg
atgcagtcccagatcggctacgacatcctggctgaggacaccatcaccgccttgctgcac
aacaaccgcaagcttctggagaagcacatcaccaagactgaggtggagacctttgtcagc
ctcgtgcggaagaaccgggagcccaggttcctggactacctctctgacctgtgcgtgtcc
aaccacatcgctattcctgtcacccaggagctcatctgcaagtgtgtgctagaccccaag
aacagtgacattctcatccaaactgagcttcggccagtgaaggagatggcccagtcccat
gagtacctgagcatcgagtactcagaggaggaagtgtggctcacttggaccgacaggaat
aacgagcaccatgagaagagcgtgaggcagctggcccaggaggcgcgggctggcaatgcc
cacgacgagaacgttctcagctactacaggtaccagctgaagctgtttgcccgcatgtgc
ctggaccggcagtacctggccattgacgagatctcccagcagctgggtgttgacctcatc
ttcttgtgcatggcggatgagatgctgccctttgacctgcgtgcctccttctgccatctg
atgctgcatgtgcacgtggacagggacccgcaggaactggtcacgcccgtcaagttcgcc
cgcctctggactgagatccccacagccatcaccatcaaggactatgattccaacctcaac
acctcccgagacgacaagaagaacaagtttgccagcaccatggagtttgtagaggactac
ctaaacaacgtggtgggcgaggccgtgccctttgccaatgaggagaagaacaagctcacc
tttgaggtggtcagcctggcgcacaatctcatctacttcggcttctacagcttcagcgag
ctgctgcggctcactcgcacgctgctgggcatcattgactgcgtgcagggacccccggcc
ttgctgcaggcttacgaggactcaggcggtaagaatgttcggcggtccatccagggtgtg
ggccacatgatgtccaccatggtgctgagcagaaagcagtctgtctttggcacccccagc
ctgtctgccagtgctggtgcccctgagccactggacagaagcaagtttgaagagaatgaa
gacatcgttgtgatggagaccaagctgaagatcctggaaatcctgcagttcatcctcaat
gtccgcctggattaccgcatctcctaccttctgtctgtcttcaagaaggagtttgtggag
gtgtttcccatgcaggacagcggggccgatggcacagcccctgccttcgactccaccact
gccaccatgaacctggatcgcatcggggagcaggcggaggccatgtttggagtggggaag
acgagcagcatgctggaggtggacgatgaaggcggtcgcatgttcctgcgtgtactcatc
cacctcaccatgcatgactatgcaccgctggtttcgggcgccctgcaactgctcttcaag
cacttcagccagcgccaggaggccatgcacaccttcaagcaggtgcagctgctgatctca
gctcaggatgtggagaactacaaggtgatcaagtcagagctggaccgactgcggaccatg
gtggaaaagtcagagctgtgggtggacaagaagggcagtggcaagggcgaggaggtggag
gcaggcgctgccaaagacaagaaggagcaacccacggatgaggaaggcttcctgcacctg
cctggggagaagagcagtgagaactaccagatcatcaagggcatcctggagcggctaaac
aaaatgtgtggtgtcggggagcaaatgaggaagaaacagcaaaggctgctcaagaacatg
gacgcccacaaggtcatgctggacctactgcagatcccctacgacaagggcgatgctaaa
atgatggagatcctgcgctacacacatcagttcctgcagaagttttgtgcggggaacccc
ggcaatcaggccctgctgcataagcacctgcacctcttcctcacaccggggctcctggag
gcagagaccatgcagcacatcttcctgaacaactaccagctgtgctccgagatgggtgag
ccagtgctacagcactttgtgcacctactggccacccacgggcgccacgtgcagtacctg
gactttctgcacacagtcatcaaggctgagggcaagtacgtcaagaagtgccaggacatg
atcatgactgagctgactaacgcaggtgacgatgtggttgtgttctacaatgacaaggcc
tctctggccaacctcctggacatgatgaaaactgcccgggatggtgtggaggaccacagc
cccctcatgtaccacatctccctggtggatttgctggctgcctgcgccgagggcaagaac
gtctacactgagatcaagtgcacctccctgctgcccctggaagacgtggtgtctgttgtg
acgcatgaggactgcatcactgaggtgaaaatggcctacgtgaacttcgtgaaccactgc
tatgtggacacagaagtagagatgaaggagatctacaccagcaaccacatctggacactc
tttgagaacttcaccctggacatcgctcgggtctgcagtaagcgtgagaagcgcctggct
gaccccaccctggagaagtatgtgctgaccgtcgtgttggacaccatcagtgccttcttc
agctctccattctctgaaaacagcacctccctgcagacacaccagacaattgtggtgcag
ctgctacagtccaccacccggctgctcgagtgtccatggctgcaacagcagctcaggggc
tccgtggaggcctgcatccggactctcgccatggtggctaagagccgggccatctcgctg
cccatggacctggatgcccacatcagctcactgctcagcagtggtgccagctgtgcagct
gctgcccagcggaacgcttccagctacaaggcagccatgagggccttcccccgtgttatc
cccaccgccaaccagtgggactacaagaacatcatcgagaagctgcaggacatcatcacg
gccctggaggagcggctgaagcctctggtgcaggctgagctgtccgtgcttgtggatgtg
ctgcactggcccgagttgctctttctggagggcagtgaggcctaccagcgctgtgagagt
gggggcttcctgtccaagctgatccagcacaccaaggaccttatggagtcagaagagaag
ttgtgtgtcaaggtgctgcggaccctgcagcaaatgctgctcaagaagaccaagtacggg
gaccggggcaatcagctgcgcaagatgctgctacaaaactacctccagaaccggaagtcc
agctcgaggggggaccttccggaccccatgggcactggcctggaccaagactggtcagca
atcgcagccacccagtgccggctggacaaggagggggccaccaagctggtgtgcgatctc
atcaccagcaccaaaaatgagaagatcttccaggagagcattggcctggccatccgcctc
ctggatggtggcaacactgagatccagaaatccttctacaacctgatgatgagcgacaag
aagtcagagcgcttcttcaaggtgctgcatgaccgcatgaagcgggcccaacaggagacc
aagtccacggtggccgtcaacatgaatgacctgggcagtcagccacaggaggaccgggag
ccagcagactccaccaccaaaggccgcgtagcctccttctcgatgcctggctcctcatcc
cgcaattatttgctgggtcccagcctgcgcagggggcacgaggtgggcgagcgtgtgcag
agcagtgagatgggcacatctgtactcatcatgcagcccatcctgcgctttctgcagctc
ctgtgtgagaaccacaaccgggatctacagaacttcttgcgctgtcagaacaacaagacc
aactacaatctggtgtgtgagacactgcagttcctggacatcatgtgcggcagcaccaca
ggtggcctggggctgctggggctctacatcaatgaggacaatgtgggcctcgtcatccag
accctggagaccctcactgagtactgccagggaccctgccatgagaaccagagctgcatt
gtgacacatgagtccaatggcatagacatcatcactgcactgattctcaatgacattagt
cccctgtgcaagtaccgtatggatctggtgttgcaactcaaggacaatgcttccaagttg
ctcttggctctgatggagagccggcacgacagtgagaacgctgagcgcatcctcatcagc
ctgcggccccaggaactggtggatgtcatcaagaaggcctatgtgcaggaagaggagcgt
gagaactcggaggtgagcccacgtgaggtgggccacaacatctacatcctggcactgcag
ctctccaggcacaacaagcagctgcagcacctgctgaagccggtgaagcgcatccaagag
gaggaggcagagggcctctcttccatgctcagcctcaacaacaagcagctgtcacagatg
ctcaagtcctctgcgccagcacaggaggaggaggaggaccccctggcctactatgaaaac
cacacatcccagatagagatcgtgcggcaggaccgcagtatggagcaaatcgtgttccca
gtgcccggcatctgccagttcctgacagaggagaccaagcaccggctcttcaccaccaca
gagcaggacgagcagggcagcaaagtgagcgacttcttcgaccagtcctccttcctgcac
aacgaaatggagtggcagcgcaagctccgcagcatgccgctcatctactggttctcccgc
cgcatgaccctgtggggcagcatttctttcaacctggcggtttttatcaacatcatcatt
gccttcttttacccctacatggagggcgcatcaacaggtgtgctgggctccccactcatc
tcactgctgttctggatcctcatctgcttctccatcgcggccttattcaccaagcactac
agtgtccgccccctcattgtggcgctcatcctgcgctccatctactacttgggcatcggg
cccacactcaacatcctgggtgccctcaatctgaccaacaagatcgtgtttgtggtgagc
ttcgtgggtaaccgtggtacctttatccggggctataaggccatgatcatggacatggag
ttcctctaccacgtgggctacatcctgactagtgtcctgggcctctttgcccatgagctc
ttctacagcatcctgctctttgacctcatctaccgcgaggagacactattcaatgtcatc
aagagtgtgacccgcaatggccgctccatcctcttgactgccctgctggccctcattctg
gtctacctcttctccatcgttggcttcctctttctcaaggatgacttcatcctcgaggtc
gaccggctgcccagcaaccactccagagccaatcctctggggatgccacatggagctgcc
acattcatgggcacgtgcagcggggacaacatagattgtgtctcaggggtctcagtgcct
gaagtcctggaagaggacaaggagccagacagcacagagcgggcttgtgacactctgctg
atgtgcattgtcaccgtcatgaaccatgggctacgcaatggtggtggtgtgggagatatt
ctccgcaagccgtccaaagatgagtccctcttcccagcccgggtggtctatgacctcctg
ttcttcttcatcgtcatcatcattgtgttgaacctcatctttggggtgatcatcgacacc
tttgctgacctgcgcagtgagaagcagaagaaagaggaggttctcaagactacgtgcttc
atctgtggtctggagagggacaagtttgataacaagacggtgtcatttgaggaacacatc
aagttcgagcacaacatgtggaactacctgtatttcattgtgctggtccgtgtgaaaaac
aagacggactacacagggcccgagagctacgtggcacagatgattaagaacaagaacctg
gactggttcccccggatgagggccatgtctctagtgagcaacgagggggagggggaacag
aacgagatccggattctgcaggacaagctcaactccaccatgaagctggtgtcccacctc
actgcccagctcaacgagctcaaggagcagatgactgagcagcggaaacgcaggcaacgc
ctgggctttgtggatgtccagaactgcatgagccgctga

KEGG   Manis javanica (Malayan pangolin): 108403293
Entry
108403293         CDS       T06054                                 

Gene name
ITPR2
Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 2
  KO
K04959  inositol 1,4,5-triphosphate receptor type 2
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04020  Calcium signaling pathway
mjv04022  cGMP-PKG signaling pathway
mjv04070  Phosphatidylinositol signaling system
mjv04114  Oocyte meiosis
mjv04210  Apoptosis
mjv04218  Cellular senescence
mjv04270  Vascular smooth muscle contraction
mjv04371  Apelin signaling pathway
mjv04540  Gap junction
mjv04611  Platelet activation
mjv04621  NOD-like receptor signaling pathway
mjv04625  C-type lectin receptor signaling pathway
mjv04720  Long-term potentiation
mjv04723  Retrograde endocannabinoid signaling
mjv04724  Glutamatergic synapse
mjv04725  Cholinergic synapse
mjv04726  Serotonergic synapse
mjv04728  Dopaminergic synapse
mjv04730  Long-term depression
mjv04750  Inflammatory mediator regulation of TRP channels
mjv04912  GnRH signaling pathway
mjv04915  Estrogen signaling pathway
mjv04918  Thyroid hormone synthesis
mjv04921  Oxytocin signaling pathway
mjv04922  Glucagon signaling pathway
mjv04924  Renin secretion
mjv04925  Aldosterone synthesis and secretion
mjv04927  Cortisol synthesis and secretion
mjv04928  Parathyroid hormone synthesis, secretion and action
mjv04929  GnRH secretion
mjv04934  Cushing syndrome
mjv04935  Growth hormone synthesis, secretion and action
mjv04970  Salivary secretion
mjv04971  Gastric acid secretion
mjv04972  Pancreatic secretion
mjv05010  Alzheimer disease
mjv05012  Parkinson disease
mjv05017  Spinocerebellar ataxia
mjv05020  Prion disease
mjv05022  Pathways of neurodegeneration - multiple diseases
mjv05163  Human cytomegalovirus infection
mjv05167  Kaposi sarcoma-associated herpesvirus infection
mjv05170  Human immunodeficiency virus 1 infection
mjv05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    108403293 (ITPR2)
   04020 Calcium signaling pathway
    108403293 (ITPR2)
   04070 Phosphatidylinositol signaling system
    108403293 (ITPR2)
   04022 cGMP-PKG signaling pathway
    108403293 (ITPR2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    108403293 (ITPR2)
   04210 Apoptosis
    108403293 (ITPR2)
   04218 Cellular senescence
    108403293 (ITPR2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    108403293 (ITPR2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    108403293 (ITPR2)
   04621 NOD-like receptor signaling pathway
    108403293 (ITPR2)
   04625 C-type lectin receptor signaling pathway
    108403293 (ITPR2)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    108403293 (ITPR2)
   04929 GnRH secretion
    108403293 (ITPR2)
   04912 GnRH signaling pathway
    108403293 (ITPR2)
   04915 Estrogen signaling pathway
    108403293 (ITPR2)
   04921 Oxytocin signaling pathway
    108403293 (ITPR2)
   04935 Growth hormone synthesis, secretion and action
    108403293 (ITPR2)
   04918 Thyroid hormone synthesis
    108403293 (ITPR2)
   04928 Parathyroid hormone synthesis, secretion and action
    108403293 (ITPR2)
   04924 Renin secretion
    108403293 (ITPR2)
   04925 Aldosterone synthesis and secretion
    108403293 (ITPR2)
   04927 Cortisol synthesis and secretion
    108403293 (ITPR2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    108403293 (ITPR2)
  09154 Digestive system
   04970 Salivary secretion
    108403293 (ITPR2)
   04971 Gastric acid secretion
    108403293 (ITPR2)
   04972 Pancreatic secretion
    108403293 (ITPR2)
  09156 Nervous system
   04724 Glutamatergic synapse
    108403293 (ITPR2)
   04725 Cholinergic synapse
    108403293 (ITPR2)
   04728 Dopaminergic synapse
    108403293 (ITPR2)
   04726 Serotonergic synapse
    108403293 (ITPR2)
   04720 Long-term potentiation
    108403293 (ITPR2)
   04730 Long-term depression
    108403293 (ITPR2)
   04723 Retrograde endocannabinoid signaling
    108403293 (ITPR2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    108403293 (ITPR2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    108403293 (ITPR2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108403293 (ITPR2)
   05012 Parkinson disease
    108403293 (ITPR2)
   05017 Spinocerebellar ataxia
    108403293 (ITPR2)
   05020 Prion disease
    108403293 (ITPR2)
   05022 Pathways of neurodegeneration - multiple diseases
    108403293 (ITPR2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    108403293 (ITPR2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108403293 (ITPR2)
   05163 Human cytomegalovirus infection
    108403293 (ITPR2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108403293 (ITPR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mjv04040]
    108403293 (ITPR2)
Ion channels [BR:mjv04040]
 Ligand-gated channels
  IP3 receptor
   108403293 (ITPR2)
SSDB
Motif
Pfam: RYDR_ITPR MIR Ins145_P3_rec RIH_assoc Ion_trans DUF2207
Other DBs
NCBI-GeneID: 108403293
NCBI-ProteinID: XP_017525821
LinkDB
Position
Unknown
AA seq 2573 aa
MNRYSAQKQYWKAKQAKQGNHTEAALLKKLQHAAELEQKQNESENKKLLGEIVKYSNVIQ
LLHIKSNKYLTVNKRLPALLEKNAMRVSLDAAGNEGSWFYIHPFWKLRSEGDNIVVGDKV
VLMPVNAGQPLHASNIELLDNPGCKEVNAVNCNTSWKITLFMKYSSYREDVLKGGDVVRL
FHAEQEKFLTCDEYEKKQHIFLRTTLRQSATSATSSKALWEIEVVHHDPCRGGAGQWNSL
FRFKHLATGNYLAAELNPDYQDAQNEGKNVRDGDIPTSKKKRQAGEKIMYTLVSVPHGND
IASLFELDATTLQRADCLVPRNSYVRLRHLCTNTWVTSTSIPIDTDEERPVMLKIGTCQT
KEDKEAFAIVSVPLSEVRDLDFANDANKVLATTVKKLENGTITQNERRFVTKLLEDLIFF
VADVLNNGQEVLDVVITKPNRERQKLMREQNILAQVFGILKAPFKEKAGEGSMLRLEDLG
DQRYAPYKYMLRLCYRVLRHSQQDYRKNQEYIAKNFCVMQSQIGYDILAEDTITALLHNN
RKLLEKHITAKEIETFVSLLRRNREPRFLDYLSDLCVSNTTAIPVTQELICKFMLSPGNA
DILIQTKLVSMQVDNPMESAILSDDVDDEEVWLYWIDSNKEPHGKAIRHLAQEAKEGTKA
DLEVLTYYRYQLNLFARMCLDRQYLAINQISTQLSVDLILRCVSDESLPFDLRASFCRLM
LHMHVDRDPQESVVPVRYARLWTEIPTKITIHEYDSITDCSRNDMKRKFALTMEFVEEYL
KEVVNQPFPFGDKEKNKLTFEVVHLARNLIYFGFYSFSELLRLTRTLLAILDIVQTPMSS
YFERLSKFQDGGNNVMRTIHGVGEMMTQMVLSRGSIFPMSVPDVQPSAHPSKHSSSAEHE
DVTVMDTKLKIIEILQFILSVRLDYRISYMLSIYKKEFGENNENAETSASGSPDSLVPSA
IVPDIDEIAAQAETMFAGRKEKNPVQLDDEGGRTFLRVLIHLIMHDYPPLLSGALQLLFK
HFSQRAEVLQAFKQVQLLVSNQDVDNYKQIKADLDQLRLTVEKSELWVEKSSSYENGEMG
ENQVKGGDEPIEESSILSPVQDGTKTPQIDSNKSNNYLIVKEILLRLSKLCVQNKKCRSQ
HQRLLKNMGAHSVVLDLLQIPYEKNDAKMNEVMNLAHTFLQNFCRGNPQNQVLLHKHLNL
FLTPGLLEAETMRHIFMNNYHLCNEISERVVQHFVHCIETHGRHVEYLRFLQTIVKADGK
YVKKCQDMVMTELINGGEDVLIFYNDRASFPILLHMMCSERDRGDESGPLAYHITLVELL
AACTEGKNVYTEIKCNSLLPLDDIARVVTHDDCIPEVKIAYVNFVNHCYVDTEVEMKEIY
TSNHIWKLFENFLVDMSRVCNTTTDRKHADTFLEKCVTESIMNIVSGFFNSPFSDNSTSL
QTHQPVFIQLLQSAFRIYNCTWPNPAQKSSVESCIRTLAEVAKNRGIAIPVDLDSQVNTL
FMKSHSNMVQRAAMGWRLSARSGPRFKEALGGPAWDYRNIIEKLQDVVASLEQQFSPMMQ
AEFSVLVDVLYSPELLFPEGSDARIRCGAFMSKLINHTKKLMEKEEKLCIKILQTLREML
EKKDSFVEEGTTLRKILLNRYFKGDYGVGMSGPLSGTYCKSAQGGGSFSGQDPDKVGTPV
SDIQCLLDKEGASELVTDVIVSTKNDRIFSEGILLGIALLEGGNTQTQYSFYQQLHEQKK
SEKFFKVLYDRMKAAQKEIRSTVAVNTIDLGNKKRDDDNELMPSGPRLRVRDSPLHLKEG
MKGQLTEASSATSKAYCVYRREMDPEIDIMCTGSELGNAEEKSAEEVTMSPAIGIMQPIL
RFLQLLCENHNRELQNFLRNQNNKTNYNLVCETLQFLDCICGSTTGGLGLLGLYINEKNV
VLVNQTLESLTEYCQGPCHENQTCIATHESNGIDIIIALILNDINPLGKYRMDLVLQLKN
NASKLLLAIMESRHDSENAERILFNMRPRELVDVMKNAYNQGLECSHGDDEGGDDGVSPK
DVGHNIYILAHQLARHNKLLQQMLKPGSDPDDGDEALRYYANHTAQIEIVRHDRTMEQIV
FPVPNICEYLTRESKCRVFNTTERDEQGSKVNDFFQQTEDLYNEMKWQKKIRNNPTLFWF
SRHISLWGSISFNLAVFINLAVALFYPFGDDGDEGTLSPLFSVLLWITVAICTSMLFFFS
KPVGIRPFLVSVMLRSIYTIGLGPTLILLGAANLCNKIVFLVSFVGNRGTFTRGYRAVIL
DMAFLYHVTYVLVCMLGLFVHEFFYSFLLFDLVYREETLLNVIKSVTRNGRSIILTAVLA
LILVYLFSIIGFLFLKDDFTMEVDRLKNRTPATGSHEVPTMTLTSMTGTCEKDSCPPTIP
ASNAAEEEYEDGIERTCDTLLLCIVTVLNQGLRNGGGVGDVLRRPSKDEPLFAARVVYDL
LFYFIVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFEEH
IKSEHNMWHYLYFLVLVKVKDPTEYTGPESYVAQMIVPTKLCSPFENEALEES
NT seq 7722 nt   +upstreamnt  +downstreamnt
atgaaccgatattctgcccagaaacagtattggaaggctaagcaagccaaacaagggaac
cacacagaggcagccctgctcaagaaattacagcatgctgcagaactggaacaaaaacaa
aatgaatcagagaataagaaactgttgggagaaattgtgaaatacagtaatgttatacaa
ctcctgcatataaaaagcaacaagtatctgactgtcaacaagagattacccgctttactg
gagaagaatgccatgcgtgtgtccctggacgctgcaggaaatgaggggtcttggttttat
attcatcccttctggaagctgagaagtgagggtgacaatattgttgtaggtgataaagtt
gttttgatgcccgtgaatgcaggacagcctctacatgccagcaacatagagcttcttgat
aatccagggtgtaaagaggtgaatgctgttaactgcaacactagctggaaaatcacttta
ttcatgaaatatagttcctatcgagaggatgtactaaaaggaggtgatgttgttagactg
tttcatgcggaacaagagaagtttctgacatgtgacgagtatgagaaaaaacagcatatt
ttccttcgtacaaccttgcgtcaatcagccacttctgctactagttctaaagcactctgg
gaaatagaggtggttcatcacgacccatgccgtgggggtgcaggtcagtggaacagcttg
ttcagatttaaacatcttgcaactgggaactacttagcagcagagcttaatcctgattat
caagatgcccaaaatgaagggaaaaacgtgagagatggagatattccaacttccaagaag
aaacgccaggcaggggagaagatcatgtatactttggtgtcggtcccacatggaaatgac
attgcgtccctttttgaactggatgctacaactcttcagagagctgactgcctggttcca
aggaactcatatgttcggttgaggcatttatgcaccaatacatgggtaaccagtaccagc
atccccatagacaccgacgaagagaggcctgttatgttgaagattggaacttgccaaaca
aaagaagataaagaagcatttgccattgtgtctgtcccgctgtctgaggtccgagactta
gactttgccaatgatgcaaataaagtgctggcgaccacagttaaaaagctggaaaatggc
acaataactcagaatgaaaggaggtttgtgaccaaattattggaagatctcatcttcttt
gttgccgatgtacttaataatggacaggaagttctggatgtggttatcaccaagccaaac
cgagaacgtcagaaattaatgagggaacagaacatattggcccaggtttttgggattctt
aaagcaccctttaaggagaaagcaggagaaggctcaatgctgagacttgaagatctgggg
gatcaaagatatgccccctacaagtacatgctgaggctctgctaccgggtgctgagacat
tcacagcaggactaccggaaaaaccaggaatatattgctaagaatttctgtgtcatgcag
tcccagatcggctatgatattttggcagaagataccatcacagctttgttgcacaacaac
agaaaactactagagaaacatatcacagcaaaagaaatagaaacatttgtcagtttgctg
aggagaaatcgtgagccaaggtttttggattatttatcagatctgtgtgtgtctaatacc
accgctatacctgtaacgcaggaactcatctgtaaatttatgttgagccctggcaatgca
gacattctcattcaaactaagctggtctcaatgcaagtagacaaccccatggagagtgcc
atcctttctgacgacgttgatgatgaagaggtctggctctactggattgatagcaacaag
gaacctcacggcaaagccatcaggcacctggctcaagaagccaaagaagggaccaaagct
gatttagaagttcttacctattacaggtatcagctaaacctctttgcaaggatgtgcttg
gatcgccagtatttggccataaaccagatttcaacacagctctctgtcgatttgatcctg
cggtgtgtgtcagatgagagcctgccatttgacctccgagcatcattttgccgccttatg
ctccatatgcatgttgatcgggacccccaggagtctgtggtgcctgttcgctatgccagg
ctctggacagaaatccccacaaagatcacaattcatgagtatgattctataacagactgt
tccagaaatgatatgaagaggaaatttgccctgacaatggaatttgttgaggaatactta
aaagaagttgtaaatcagccctttccttttggagataaagaaaaaaacaaactgacattt
gaggtggtccacttggctcgcaatcttatatattttggattttatagtttcagtgaatta
ttaaggctaacaagaacacttctggctatcctagatattgtacaaacccccatgtcatcg
tattttgaaagattaagtaaatttcaagatggaggaaacaatgtcatgaggaccatccac
ggcgtgggggagatgatgacccagatggtgctcagcagaggctccatcttccccatgagt
gtgcccgacgtgcagcccagcgcccatcccagcaagcacagcagctctgccgagcacgag
gacgtgaccgtgatggacaccaaactgaagattatcgagattttgcagtttatcctgagt
gtcagactagattataggatctcatatatgctgtcaatatataagaaggaatttggagag
aacaatgaaaatgctgaaacgtctgccagcggctctccggattcattagtgccatcagcc
attgttcctgatatagatgaaattgcagcacaggcagaaactatgtttgctggaaggaag
gaaaaaaacccggtccagctggatgatgaaggcggcaggacgtttctgcgagtcctcatc
catctgatcatgcacgattacccccctctgctgtcgggggccctgcagttgctcttcaag
cacttcagccagagggccgaggtcttacaggcatttaagcaggtgcagttgctggtgtcc
aatcaggatgtagataactacaagcaaatcaaggcagatctagaccagcttcggctaact
gtagaaaaatctgagttatgggttgagaaaagcagcagctatgagaacggagaaatgggt
gaaaatcaagtaaaaggtggtgacgagccaattgaggagtccagcattttaagcccagtt
caggacggaacaaagacacctcagattgacagcaataagagcaataactacctgattgta
aaggagattttactcaggctaagtaaactctgtgtgcagaataaaaagtgtcggagtcaa
catcaaagattactaaaaaacatgggggctcattcagtggtgttggaccttctgcagata
ccctatgagaagaacgatgcaaagatgaatgaagtaatgaatctggcccatacgttcctg
cagaatttctgtcggggaaatccacagaatcaggttctccttcataaacatctgaatttg
tttttaactcctggtctcctcgaagcagaaaccatgcggcacatcttcatgaacaattac
catctatgcaatgaaattagcgagagagtcgtgcagcatttcgtgcactgcatcgagacg
cacggccgccacgtggagtacctgaggtttctgcaaacgattgtaaaagcagatggtaaa
tatgtgaagaaatgccaggatatggtaatgacagagttgataaatgggggtgaagatgtg
ctgatattttacaatgatagagcgtcatttcccatccttctccatatgatgtgttcagag
agagaccgaggggatgagagcggccccttggcctaccacatcacccttgtggagctgctg
gcagcatgcacggaggggaagaatgtctacaccgaaatcaagtgcaactcccttctgccc
ctggacgacatagcgagggtggtgactcatgacgactgcatccctgaggttaaaattgct
tatgtgaattttgttaatcactgttacgtggacactgaagtggaaatgaaagaaatctac
acgagtaaccacatttggaaattgtttgagaacttcttggtggatatgtcaagggtctgc
aatacgaccacagacaggaaacacgcggacaccttcttggagaagtgtgtcaccgagtcc
atcatgaacatcgtgagcggcttctttaattctcctttttcagacaacagtaccagcctc
cagacccatcagccggttttcattcagctgctgcagtccgccttcagaatttataattgc
acctggccaaacccggcgcagaaatcctcggtggagtcctgtatccgaactttggctgaa
gtggcaaagaatcggggaatcgccattccagtggatttagacagccaagtcaatactctt
ttcatgaagagccactcaaacatggtgcagagagcagccatgggctggaggctctcagct
cgctcggggccacgctttaaggaagctcttggagggcctgcttgggattatagaaatatt
attgaaaagttacaggatgttgtggcctccttggagcaacagttcagccccatgatgcag
gctgagttctcagtgctggtcgacgtgttgtacagtccagagctactgttccccgagggg
agcgatgcaagaataagatgtggcgctttcatgtccaagttgataaatcatacaaagaaa
ctaatggagaaagaagaaaagctgtgcattaaaattcttcagactttacgagaaatgcta
gagaagaaagacagctttgtggaagagggtaccacattaagaaaaatactcttgaatcgg
tactttaaaggtgattatggagttggcatgagtggacccctctctggaacctactgcaaa
tctgcacaagggggaggaagcttttctggacaagatcctgataaggtggggacaccagtg
tcagatattcagtgcctgctggataaagaaggtgcgtccgaacttgtcaccgatgtcatc
gtgagcaccaaaaatgacaggattttttcagaaggcattttacttggcattgccctgctc
gaaggaggaaatacacagactcagtattctttctaccagcagttgcatgaacaaaaaaag
tcagagaaattcttcaaagttctgtatgaccgaatgaaggctgctcagaaagagataaga
tcaacagtggcagtgaacaccatagacttaggaaacaagaaaagggatgatgacaatgaa
ttgatgccctctggcccacgattgagagtaagagattcaccattacatttaaaagaggga
atgaaaggacagttgacggaagcttcttcagccacatccaaagcgtactgtgtgtacaga
agagaaatggaccccgaaatagacattatgtgtacaggatcagagctgggaaacgccgag
gaaaagtctgccgaggaagtgaccatgagtcctgccatcggcatcatgcagcccatcctg
agattccttcagttactgtgtgagaatcacaaccgagaactgcagaactttttgaggaat
caaaacaacaaaacaaattacaaccttgtctgtgagacccttcaatttttggactgcatt
tgtggaagtacaacgggtggcctgggcctcttgggcctctacatcaatgaaaagaatgta
gtgctggtcaaccagactctggaaagcttgaccgagtattgccagggcccatgccatgaa
aatcagacttgtattgctactcatgaatctaatgggattgatatcatcattgctttgatt
ctgaatgacataaacccccttggtaaatatcgaatggatttggtgctccagctaaagaac
aatgcctccaaactcctgctggccattatggaaagcagacacgacagcgaaaatgcagaa
agaattctttttaacatgagacccagggaattggtggatgtgatgaagaacgcctataac
caagggttggaatgcagtcatggggatgatgagggcggagatgatggtgtttccccaaaa
gacgttggacacaatatctatattctggcccatcagttggcccgtcacaacaagctgtta
cagcagatgctcaaacccggatcggatccagatgatggagatgaagccttaaggtattat
gctaaccatactgcacaaatcgagattgttcggcatgacagaactatggagcaaatagtt
tttcctgtccccaatatatgtgaatatcttactcgagaatccaagtgccgtgtgttcaat
acaactgaaagggacgagcaaggaagcaaagtaaatgactttttccagcaaacagaagat
ctttacaacgaaatgaagtggcaaaagaaaatcaggaataaccccacgctcttctggttc
tcgcggcacatctctctctgggggagcatttccttcaacttggccgtgttcatcaatcta
gctgttgctctcttctacccgtttggggatgatggagatgaaggtacactttccccactg
ttctcagttctcctttggataacagttgcaatttgtacatctatgctgtttttcttctcc
aagcctgtgggtattcggccatttcttgtgtcagtaatgctcagatcaatatatacaata
ggtcttgggcctacattaatacttcttggtgcagctaatctttgtaataaaatcgtattt
ctggtgagttttgtcggaaatcgtggcacattcacccgaggctaccgcgcggtcatcctg
gatatggcctttctctaccacgtaacatatgtcctggtgtgcatgctgggtctttttgtc
catgaattcttctacagcttcctgctttttgatttggtgtacagagaagagactctgctc
aatgtcataaaaagcgtcacacggaacggccgctccattatcctaactgccgtcctcgcc
ctcatcctcgtctacctgttttccattattgggttcctttttctgaaggacgacttcacc
atggaagtggataggctgaaaaacaggactcctgccacaggtagtcatgaagttcctaca
atgactttaacttcaatgacgggaacctgtgaaaaggacagttgcccacccaccatccca
gcttcaaacgcagctgaggaagagtatgaagatggaatcgaaaggacgtgtgacaccctc
cttctgtgcatagtcactgtcctgaaccaaggcctcaggaacggcggcggtgtgggggac
gtgctgaggaggccatcgaaggatgagcccttgtttgctgcccgagtggtatatgatctc
cttttctatttcatcgttatcattatcgttcttaacctgatttttggtgttatcattgat
acttttgctgatctcagaagtgaaaaacagaaaaaagaagagattctgaagacaacctgc
ttcatctgcggacttgagagggacaagtttgataataaaactgtttcgtttgaagagcac
atcaagtcagaacacaatatgtggcattatttgtacttcctagtcctcgtgaaggtgaaa
gacccaactgaatacactggacccgaaagctatgtggctcaaatgatcgtgccgacaaaa
ttgtgttcaccctttgagaatgaggccttagaagagtcatga

DBGET integrated database retrieval system