KEGG   Manis javanica (Malayan pangolin): 108396083
Entry
108396083         CDS       T06054                                 

Gene name
REV3L
Definition
(RefSeq) DNA polymerase zeta catalytic subunit isoform X1
  KO
K02350  DNA polymerase zeta [EC:2.7.7.7]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01524  Platinum drug resistance
mjv03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    108396083 (REV3L)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108396083 (REV3L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mjv03400]
    108396083 (REV3L)
Enzymes [BR:mjv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     108396083 (REV3L)
DNA repair and recombination proteins [BR:mjv03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   B-family DNA polymerases
    108396083 (REV3L)
SSDB
Motif
Pfam: DUF4683 DNA_pol_B DNA_pol_B_exo1
Other DBs
NCBI-GeneID: 108396083
NCBI-ProteinID: XP_017514288
LinkDB
Position
Unknown
AA seq 2764 aa
MASSIDRALNVALGNPSSTAQHVFKVSLVSGMPFYGYHEKERHFMKIYLYNPAMVKRICE
LLQSGAIMNKFYQPHEAHIPYLLQLFIDYNLYGMNLINLAAVKFRKARRKSDPLCATGSC
KDRLTGNSFTGTLFRWEEDEIPSSLILEGVEPQSTCELEVDAVAADILNRLDIEAQIGRN
PGLQAIWEDEKQRRRNRSETSQISQPESQDHRFVPATESEKKFQKRLQEVLKQNDLSVRT
LSGSVGYSDASQGLSAELTLYSEALSPESLPCTPANMVEVHKDTELSKGHIKYKLEEAVI
NEEAILNVMENSQTFQPLTQRLSESAVFLGSSPDEALVHLLAGLENDGYRGERHRMPSSC
AFGNIKNLQNSDDEENEPQIEKEEMELSLVMSQRWDSNIEEHCAKKRSLCRNTQRSSTEE
DSSSEEEMDWSSDSLLLANLSIPQLDGTADENSDNPLNNENSRTHSSVIAASKLSVKPSI
FHKDAATLEPPSSAKITFQCKHTSALSSHVLNKEDLIEDLSQPHNKEKGLDHSAPAFTSE
STYSMKYPGSVSSTVHSENSQKESSKKDILPVSSCESSIFDYEEDTPSVTRQVPSRKYTN
IRKIDKDAPFKHMNRHTSESTLSKNSFNFTDSCHSKSKSTSEGSEKRHSTAMNSLFPSSL
TENCELLSCSGEKRTVVHSLDSIADESGLNKLKIRYEGFQEHKTEKPSLSQQAAHYMFFP
SVVLSNCLSRPQKLSPVTYKLHPSNRQPRLKMNRKKCIVHQETSTKTSETGPTKENCVQS
HPCHSHPEKDGTLASDVIKVTRGAFENKTPMDSFIECRFGDGTLDTEQTFGLYGNKYTLR
AKRKVNYETEDSESGFVTHNTKISLPHPTEIGGSIGGNLKSRKRRKMSKKLPPVIIKYII
INRFRGRKNMLVKLGKIDSKEKQVILTEEKMELYKKLAPLKNFWPKVPDSPATKYPIYPL
TPKKSHRRKSKHKSAKKKTGKQQRTNSESIKRPLSFRKKRSHAVLSPPSPSYSAETEDCD
LNYSDVMSKLGFLSERSTSPINSSPPRCWSPTDPRAEEIMAAADKQVTLFKGLNAHSSKT
VNSRIEKNRRARAQAKKSKTKLVNPPVVTKKRNKRNQTNKLVDDGKKRPRAKQKQKTNGK
GTPRKHITFKDEKVKSQPVLKYQHVSESPRRAGGSPLLFKQREVSPAGSAVGPPLSAPLP
TGVHAQQNSPGCFSSFLESKKPGGVQTFPSSRDNVYSSVVCSSLGPGISKVNVQRSHNQS
AMFTLKESTLIQKNIFDLSNRLSQVAQNTQTSPGIMSPKTEDSANIQKNYLSSFGKLSEY
HNPVDPQPDQTCAPGFLHCRESQQQPVCMAEPPKPSEACPPGSAAADESQTSDSCPVTSW
RSPIKRIAWGQKQRGFVLDMSNFKSEGIKERALSEAISQTKALSQCKNRTVPAPSAFGEG
QSGLAVLKELLQKRQQKAQNANIMQDPLSSKQQPNKNISDSLEHNRTIKRTRPVTSPRKP
RTPRSTKAKEKIPKLRKVDSLNLQNSGQVDNSASDDSPIFFSDPGFESCYSLEDSLSPEH
NYNFDINTIGQTGFCSFYSGSQFIPADQNLPQKFLSDAAQDPFPGQTIEKPEFLNHDDQK
CGDARRRASASWVGPSTASPELFDGSDSRCHDQWESSFHSLTTRSNSLMDSFCVQQAEDC
SNEKPRLSGSSVSKEVFLSLSQPGHSGWIPGRARKGAGQPLDTGSASCTTRLPSPDGELA
DAASEDLELYASRNNDMLTPTPDSSPRSTSSPSQSKNGSFTPRTAHILKPLMSPPSREEI
MATLLDHDLSETTYQEPFCSNPSDVPEKPREIGGRLLMVETRLPNNLAEFEGDFSLEGLC
LWKTAFSAMTQNPRPGSPLRNGQPVVNKGSSISHKMVEDKKIVIMPCKCAPSRQLVQAWL
QAKEYERSKKLCKIELAAVEMSAENFTSSVNPDDQPVVPPKAGTAPHVLPTTAYAKEDAG
DSQISFQAPSTGGCSGTVSEGQALPPALSSNDPEKEEDGDAYYVSYSSPDSPVIPPWQQV
TSPNSKTLNGGGSLPSPVEELHSLTTENSLQLVKGGTQKSPCSEPPEPPVMSPINVRART
RACEALRLHSTPIPQRRPVERPPETAGLSPLSAEPKTQKLSHKKGSNTDTLRRRVLLTPV
KNQFAAVNTPKKETSQIDGPSLNNTYGFKVSIQNLQEAKALHEIQNLTLISVELHARTRR
DLEPDPEFDPICAVFYCVSSDTALPDTDRTELTGAVVIDKDRAASSQDIRYKTPLLIRSG
ITGLEVTYAADEKALFQEIADIIKRYDPDILLGYEIQMHSWGYLLQRAAALSVDLCQMIS
RVPDDKFENRFAAERDEYGSDTMSEINIVGRITLSLWRIMRNEVSLTNYTFENVSFHVLH
QRFPLFTFRVLSDWFDNKTDLYRWKTVDHYISRVRGNLQMLEQLDLIGKTSEMARLFGIQ
FLHVLTRGSQYRVESMMLRIAKPMNYVPVTPSTQQRSHMRASQCTPLIMEPESRFYSNSV
LVLDFQSLYPSIVIAYNYCFSTCLGRVESLGKYDEFKFGCTSLRIPPDLLYQIRHDITVS
PNGVAFVKPSVRKGVLPRMLEEILKTRLMVKQSMKAYKQDRALSRMLDARQLGLKLIANV
TFGYTAANFSGRMPCTEVGDSIVHKARETLERAIKLVNDTKKWGARVVYGDTDSMFVLLK
GATKEQSFKIGQEIAEAVTAANPRPVRLKFEKVSATRCRRHTGSHHRYVFRIQAGLRAFE
SINI
NT seq 8295 nt   +upstreamnt  +downstreamnt
atggcatccagtatcgacagagcacttaatgtggctttaggcaatccatcttctactgct
cagcacgtgttcaaagtgtcattagtatcaggaatgcctttttatggttatcatgaaaag
gaaagacactttatgaagatctatctttacaatcctgcaatggtgaaaaggatatgtgaa
cttttgcaaagtggagccataatgaataaattttaccagcctcatgaagcgcatattccc
tacctcctacagctcttcatcgactacaatctctatggaatgaatttaataaatctggct
gctgtcaagttccgaaaagcaagaaggaaaagtgatccattgtgtgcaactggatcttgc
aaagatcggctaacaggaaattcttttactggtactttatttcggtgggaagaagatgaa
ataccaagctctttaatactggaaggtgttgaaccacagagcacatgtgagttagaagtg
gatgctgtagctgctgatatcttaaatcggctggacattgaagctcaaattggcagaaac
cctggtctgcaggctatatgggaagatgaaaagcaacggcgaagaaacagaagtgaaact
tctcaaatcagccaacctgaatcacaagatcacaggtttgtgccggcaacagaaagtgaa
aaaaaatttcagaagagacttcaggaagttctcaaacagaatgatttatctgtcagaaca
ttatcaggatctgtgggctacagcgatgcatcccaggggctctccgctgagctgacgctg
tattctgaggctctgtctcctgaaagtcttccatgtacgccggctaatatggtagaagtc
cacaaagacacagaactgagcaaaggtcacattaaatacaaactggaggaagctgttatt
aatgaagaggcaattttgaacgtcatggaaaatagtcagacttttcagcctttaacccaa
agactgagtgagtcagcagttttcttggggagtagtcctgatgaggccctggtacatctt
cttgctggtttggaaaatgatggatatcggggggaaaggcataggatgccatcatcatgt
gcttttggaaacatcaagaatctccaaaatagtgatgatgaagaaaatgaaccacagatt
gaaaaagaagaaatggagcttagtttggtgatgtctcagagatgggacagcaatattgaa
gaacactgtgccaaaaagagatcactgtgcagaaacacccagagaagctcaactgaagaa
gattcgtcttcggaagaagagatggactggagtagtgacagcttgcttctagccaacctc
tctatacctcagctcgatggaactgcagatgagaacagtgacaatccactgaacaacgaa
aattccagaacccactcttctgtgatcgcagccagcaagctgtctgtaaaaccttcgatc
tttcacaaagatgctgctacattagagcccccatcttcagctaagatcacctttcagtgc
aaacacacaagtgccctttcttcccatgttttgaacaaggaagatttaattgaagacctt
tcacaaccacacaacaaggaaaaaggtctggatcattcagctcctgcttttacaagtgaa
agcacttactctatgaaataccctggatctgtaagcagcactgtccattcagaaaactct
caaaaagaaagtagcaagaaagatatcctcccagtatcttcctgtgaaagtagtattttt
gattatgaagaagatactccatccgttacaagacaagtaccaagtagaaagtatacaaac
attagaaaaattgataaagatgccccttttaaacatatgaaccgtcacactagcgaaagt
acattgagcaaaaattctttcaactttactgactcatgtcattcaaaaagcaaatcaacc
tctgaaggaagtgaaaaaagacacagcacagctatgaatagcttgttcccttcatcattg
actgaaaactgtgagctgctgtcatgctcaggggagaaaagaactgtggtacattctctt
gatagcattgctgatgaaagtggactcaataagcttaaaattagatatgaaggatttcaa
gaacataaaacagaaaagccaagcctcagccagcaagcagcacattatatgtttttcccc
agtgttgttctctctaactgtctcagtaggccacagaaactctcccctgtcacatacaaa
ctacaccccagcaataggcagccccggttaaaaatgaacaggaagaaatgtatagttcac
caggagacttctaccaaaactagtgagactggacccacaaaagagaactgtgtgcaaagt
catccttgtcacagtcaccctgagaaggatggcacattggccagtgatgtgattaaagtc
actcgtggagcttttgaaaataaaacacctatggacagttttatagagtgccgctttgga
gatgggacattagacactgagcagacctttgggttgtatggaaacaagtacacgcttaga
gccaaacgcaaggtgaattatgagactgaggatagtgagtcaggttttgtaacacacaac
acaaaaatcagcctacctcatcccacggaaattggtggaagtataggtggaaatctcaaa
tctcgaaaacgaagaaaaatgtctaaaaagctgccccctgtcatcataaagtatattatt
attaatagatttagagggagaaaaaatatgcttgtgaagctaggaaaaatagactctaaa
gaaaaacaagtaatattaacagaagaaaaaatggaattgtataaaaagcttgcacctttg
aagaatttttggccaaaagttcctgactcccctgcaaccaaataccccatttatccacta
acaccaaagaaaagtcacagaagaaaatcaaaacataagtctgctaagaaaaaaactggt
aagcaacaaaggacaaatagtgagagtattaaaagacctttgtctttcaggaaaaaacgg
tcccatgctgttctttcacccccatcaccatcttacagtgctgaaaccgaagactgtgac
ttgaattacagtgatgttatgtctaaactaggttttctttctgagagaagcacaagtccc
ataaattcttctccacctcgctgctggtctcccacagatccaagagctgaagaaattatg
gctgctgcagataaacaagtgacgctttttaagggtcttaatgcacatagtagcaagacc
gttaattctcgtatagaaaaaaatagacgagcaagagcacaggctaagaaatcaaagacg
aagcttgttaatccccctgtagttaccaagaaaaggaacaaacgaaatcagacaaataaa
ctagtagatgatgggaaaaagagaccgcgagcgaaacagaaacagaaaacaaatgggaaa
ggtacgccaagaaagcacataacgtttaaggatgaaaaggtaaaatctcagcctgtgctg
aaatatcagcatgtgtctgagtcccccaggcgtgctggaggctctccactgctattcaaa
cagagagaggtgtcaccagcaggctctgctgtggggcctcccctgtctgccccactgccc
actggagtccatgcacaacagaattcacctggctgcttttcttctttcttagaaagcaag
aagcctggaggtgtgcagacattccccagttcacgagataatgtgtattcatcggttgtt
tgtagctctttgggacctggaatctccaaagttaacgttcagaggtctcataatcaaagt
gctatgtttactctgaaggaatcaaccttaattcaaaaaaatatattcgacctttccaac
cgtttgtctcaggtagcacagaatacacagacatctccaggtataatgtctccaaagaca
gaagatagtgcaaatatacaaaaaaactacttgtcatctttcggaaaattaagtgaatat
cataatcccgtagacccacagccagaccagacgtgtgcccctggttttttgcactgcaga
gaaagtcagcagcagcctgtgtgcatggcagagcctccgaagcccagcgaggcctgtcct
cccggaagtgcagcagcggacgagagccagacatctgacagctgccctgtgacttcctgg
agaagcccgatcaaacggatcgcatgggggcaaaaacaaaggggctttgttttagatatg
tcaaattttaaatctgaagggataaaagagagggcactgtcagaagccatttcacaaacc
aaagcactttctcagtgtaaaaatcgaactgtgccagcaccttcagcatttggtgaagga
cagtctggactggcagttctaaaagaattgttacagaaaagacagcagaaagcacaaaat
gcaaatattatgcaagacccattatctagtaagcagcaaccaaacaaaaatatttctgat
tcccttgagcataacagaacaattaaacgaacacgaccagtaacatctccaagaaaacct
cgaactcccagaagtacaaaagctaaagagaaaattcccaaacttcgtaaagtagactct
ctaaatttacaaaactctggccaagtggataactccgcgtcagatgacagtcccatcttt
ttttcagatccaggttttgaaagttgttactcacttgaagatagcttgtctcccgaacat
aattataattttgatattaatacaataggtcaaactggattttgtagcttctattctgga
agtcagttcatcccagctgatcagaatctgccgcagaagttcttgagtgatgcagctcag
gatcctttcccaggacagacgatagaaaagcctgagtttttaaatcacgatgaccagaag
tgtggtgatgcccggcgccgcgcctcagcctcttgggtaggacccagcaccgccagtccc
gagctctttgacggcagcgacagtcgctgccacgaccagtgggaaagcagctttcactct
ctgaccacccggtctaattcgttgatggattctttctgtgtccagcaggcagaggactgt
tcaaacgaaaagcccagactgagcgggagctcggtgagtaaggaggtgtttctgagcctc
tcgcagccaggccactccggctggattccgggccgtgccaggaagggtgcggggcagccc
ctcgacacaggcagtgcctcttgcaccacgaggctgccctcccctgacggcgaacttgcg
gacgcggcctctgaagacttagaactgtacgcttcgaggaataacgacatgctgacaccg
acccccgacagctcaccgaggtccacgagctctccctcacaatccaaaaatggcagtttc
acccctcgaactgctcacattctgaaaccacttatgtccccaccaagtagggaagaaatt
atggcaactttattggatcatgacctttcagaaaccacttaccaggaacccttctgcagc
aatccttcggatgtgccggaaaagcccagggagattggtggacggcttctcatggtagaa
actcgacttccaaataatctggctgagtttgaaggagacttttccttggaaggactttgt
ctgtggaaaacagcattctcagctatgactcagaatccaagaccaggatccccccttcgc
aatggccaaccagttgtcaataaagggtcaagtattagccataaaatggttgaagataaa
aaaattgtgatcatgccttgcaaatgtgccccaagtcgacaactggttcaagcatggctt
caagccaaagaatatgagcgctccaagaaactgtgcaagattgagctggctgcggttgaa
atgtctgctgagaacttcacctcctcagttaacccagacgaccaacctgtagtgcctcca
aaagcgggtacagctccacacgtgctccccactacggcatatgccaaggaagatgctggt
gattctcagatttctttccaggcaccatctacaggaggatgcagtggaactgtaagtgaa
ggtcaggcgctgccaccggctctttcttcaaatgaccctgagaaagaagaagatggcgat
gcctattatgttagttacagctccccggattctccagtaattcccccttggcaacaagta
acatccccaaattccaaaacattaaatggaggtggcagccttccgtccccggtggaggaa
ctgcattccctgaccactgagaactcgttacagctggtaaaaggtggaacgcagaaaagc
ccctgcagtgagcctccggagcctccggtgatgtctcccatcaacgtcagggcgagaacc
agggcgtgcgaggccctccgccttcacagcacacccatcccgcagagaagacctgtggaa
aggcctcctgagaccgccggccttagcccattatcagcagaaccaaaaacccagaaattg
agtcataagaaaggaagtaacactgacactcttagaagaagagtgctcttaacaccagta
aagaatcaatttgcagcagtaaacaccccaaagaaagaaacttctcagattgatggacca
tccttaaacaatacttacggtttcaaagtcagcatacaaaatctgcaggaggcaaaggct
ttacatgagattcaaaatcttaccctcatcagcgtggagttacatgctcgaactagacga
gacttagagccagaccctgagtttgatcctatctgtgctgtgttctactgcgtctcgtct
gacaccgcgctgccggacacagaccgaacggagctcacgggcgccgtagtgatcgacaaa
gacagggcagcctccagtcaagacatcaggtataagactccattacttataagatctgga
attacaggactagaagttacctatgctgctgatgagaaagcgctttttcaggaaattgca
gatataataaagagatatgatcctgatattctgctaggatatgagattcagatgcattcc
tggggttatctcttacaaagagctgctgccttaagtgttgatttatgtcagatgatctcc
cgggtgccagatgacaaatttgagaatagatttgcagctgaaagagatgagtatggatca
gatacaatgagtgagataaatatcgttggccgaattacactaagtctttggagaatcatg
agaaatgaggtgtcgctaactaactacacctttgaaaatgtgagctttcacgttcttcat
cagcgttttcccctcttcacctttcgagtcttatcagattggtttgataacaagacagat
ctatacagatggaaaacagttgatcattacataagccgtgtccgtggaaatctccagatg
ttagagcagctggacctgattgggaaaacaagtgaaatggctaggctttttggcattcag
tttttacatgtactcacaaggggttcacagtaccgtgtggagtccatgatgctgcggatc
gctaaaccgatgaactacgtccccgtgacgcccagcacgcagcagaggtcccacatgagg
gcgtcgcagtgcacccccctaatcatggagcccgagtcccgcttctacagcaactccgtc
ctggtgctggatttccagtctctgtacccgtctattgtgatcgcgtacaactactgtttc
tccacctgccttggccgtgtggagagcttgggaaagtatgatgagttcaagtttggctgc
acctctctaagaatacctccagatttactttaccaaattcggcatgatatcaccgtgtcc
cccaacggggtagcctttgtcaagccttcagtaagaaagggtgtgctaccaagaatgctt
gaagaaattttgaagactagactaatggtgaagcagtcaatgaaggcttacaaacaagac
agagctctttcacgaatgctcgatgcacgtcagctgggacttaagcttatagcaaatgtc
acatttggctatacagctgctaatttttctgggagaatgccatgcactgaggttggtgat
agtattgttcacaaagccagagagaccttggaacgagctattaaactggtgaatgatacc
aagaaatggggtgctagggttgtatatggtgataccgacagtatgtttgtgctactcaaa
ggagccactaaggagcagtcatttaagatcgggcaggaaattgctgaagccgtgactgcg
gccaaccccagacctgtgagactcaagtttgagaaggtaagcgcgactcggtgccgacgg
cacacaggttctcaccacaggtacgttttcagaattcaggccggtttacgggcctttgaa
agcattaacatttaa

DBGET integrated database retrieval system