KEGG   Manis javanica (Malayan pangolin): 108396286
Entry
108396286         CDS       T06054                                 

Gene name
FHL1
Definition
(RefSeq) four and a half LIM domains protein 1 isoform X1
  KO
K14365  four and a half LIM domains protein 1
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108396286 (FHL1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mjv04990]
    108396286 (FHL1)
Domain-containing proteins not elsewhere classified [BR:mjv04990]
 LIM domain-containing proteins
  FHL family proteins
   108396286 (FHL1)
SSDB
Motif
Pfam: LIM Ureidogly_lyase
Other DBs
NCBI-GeneID: 108396286
NCBI-ProteinID: XP_017514563
LinkDB
Position
Unknown
AA seq 339 aa
MASHRHSGPSSYKVGTMTEKFDCHYCRDNLQGKKYVQKDGHHCCLKCFDKFCANTCVECR
KPISADSKEVHYKNRYWHDTCFRCAKCFHPLANETFVAKDNKILCNKCTTREDSPKCKGC
LKPIVAGDQNVEYKKTVWHKDCFTCSNCKQVIGTGSFFPKGEDFYCVTCHETKFAKHCVK
CNKAITSGGITYQDQPWHAECFVCVTCSKKLAGQRFTAVEDQYYCVDCYKNFVAKKCAGC
KNPITGKRTVSRVSHPVSKARKPPVCHGKRLPLTLFPSANLRGRHPGGERTCPSWVVVLY
RKNRSLAAPRGPGLVKAPVWWPMKDNPGTTTASTAKNAP
NT seq 1020 nt   +upstreamnt  +downstreamnt
atggcttcccacagacactcaggtccttccagctacaaggtgggcaccatgactgagaag
tttgactgccactactgcagggacaacctgcagggaaagaagtatgtgcagaaggacggc
caccactgctgcctgaaatgctttgacaagttctgtgccaacacctgtgtggaatgccgc
aagcccatcagcgcggactccaaggaggtgcactataagaaccgttactggcatgacacc
tgcttccgctgtgccaagtgcttccaccccttggccaatgagacctttgtggccaaggac
aacaagatcctgtgcaacaagtgcaccactcgggaggattcccccaagtgcaaggggtgc
ctgaagccaattgtggcaggagatcaaaatgtggagtacaagaagaccgtctggcacaaa
gactgcttcacctgcagcaactgcaagcaagtcatcgggaccggaagcttcttccctaaa
ggggaggacttctactgcgtgacttgccacgagaccaaatttgccaagcattgtgtgaag
tgcaacaaggccatcacatctggaggaatcacttaccaggatcagccctggcatgccgag
tgctttgtgtgtgttacctgctctaagaagctggctgggcagcgtttcaccgctgtggag
gaccagtattactgcgtggattgctacaagaactttgtggccaagaagtgtgctggatgc
aagaaccccatcactgggaaaaggactgtgtcaagagtgagccacccagtctctaaagct
aggaagcccccagtgtgccacgggaaacgcttgcctctcaccctgtttcccagcgccaac
ctccggggcaggcatccgggtggagagaggacttgtccctcgtgggtggtggttctttat
agaaaaaatcgaagcttagccgctcctcgaggcccgggtttggtaaaggctccagtgtgg
tggcctatgaaggacaatcctggcacgactactgcttccactgcaaaaaatgctccgtga

DBGET integrated database retrieval system