KEGG   Manis javanica (Malayan pangolin): 108397005
Entry
108397005         CDS       T06054                                 

Gene name
RELA
Definition
(RefSeq) transcription factor p65
  KO
K04735  transcription factor p65
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01523  Antifolate resistance
mjv04010  MAPK signaling pathway
mjv04014  Ras signaling pathway
mjv04024  cAMP signaling pathway
mjv04062  Chemokine signaling pathway
mjv04064  NF-kappa B signaling pathway
mjv04066  HIF-1 signaling pathway
mjv04071  Sphingolipid signaling pathway
mjv04137  Mitophagy - animal
mjv04151  PI3K-Akt signaling pathway
mjv04210  Apoptosis
mjv04211  Longevity regulating pathway
mjv04218  Cellular senescence
mjv04380  Osteoclast differentiation
mjv04620  Toll-like receptor signaling pathway
mjv04621  NOD-like receptor signaling pathway
mjv04622  RIG-I-like receptor signaling pathway
mjv04623  Cytosolic DNA-sensing pathway
mjv04625  C-type lectin receptor signaling pathway
mjv04657  IL-17 signaling pathway
mjv04658  Th1 and Th2 cell differentiation
mjv04659  Th17 cell differentiation
mjv04660  T cell receptor signaling pathway
mjv04662  B cell receptor signaling pathway
mjv04668  TNF signaling pathway
mjv04722  Neurotrophin signaling pathway
mjv04917  Prolactin signaling pathway
mjv04920  Adipocytokine signaling pathway
mjv04926  Relaxin signaling pathway
mjv04931  Insulin resistance
mjv04932  Non-alcoholic fatty liver disease
mjv04933  AGE-RAGE signaling pathway in diabetic complications
mjv05010  Alzheimer disease
mjv05022  Pathways of neurodegeneration - multiple diseases
mjv05030  Cocaine addiction
mjv05132  Salmonella infection
mjv05133  Pertussis
mjv05134  Legionellosis
mjv05135  Yersinia infection
mjv05140  Leishmaniasis
mjv05142  Chagas disease
mjv05145  Toxoplasmosis
mjv05146  Amoebiasis
mjv05152  Tuberculosis
mjv05160  Hepatitis C
mjv05161  Hepatitis B
mjv05162  Measles
mjv05163  Human cytomegalovirus infection
mjv05164  Influenza A
mjv05165  Human papillomavirus infection
mjv05166  Human T-cell leukemia virus 1 infection
mjv05167  Kaposi sarcoma-associated herpesvirus infection
mjv05168  Herpes simplex virus 1 infection
mjv05169  Epstein-Barr virus infection
mjv05170  Human immunodeficiency virus 1 infection
mjv05200  Pathways in cancer
mjv05202  Transcriptional misregulation in cancer
mjv05203  Viral carcinogenesis
mjv05212  Pancreatic cancer
mjv05215  Prostate cancer
mjv05220  Chronic myeloid leukemia
mjv05221  Acute myeloid leukemia
mjv05222  Small cell lung cancer
mjv05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mjv05321  Inflammatory bowel disease
mjv05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108397005 (RELA)
   04014 Ras signaling pathway
    108397005 (RELA)
   04064 NF-kappa B signaling pathway
    108397005 (RELA)
   04668 TNF signaling pathway
    108397005 (RELA)
   04066 HIF-1 signaling pathway
    108397005 (RELA)
   04071 Sphingolipid signaling pathway
    108397005 (RELA)
   04024 cAMP signaling pathway
    108397005 (RELA)
   04151 PI3K-Akt signaling pathway
    108397005 (RELA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    108397005 (RELA)
  09143 Cell growth and death
   04210 Apoptosis
    108397005 (RELA)
   04218 Cellular senescence
    108397005 (RELA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108397005 (RELA)
   04621 NOD-like receptor signaling pathway
    108397005 (RELA)
   04622 RIG-I-like receptor signaling pathway
    108397005 (RELA)
   04623 Cytosolic DNA-sensing pathway
    108397005 (RELA)
   04625 C-type lectin receptor signaling pathway
    108397005 (RELA)
   04660 T cell receptor signaling pathway
    108397005 (RELA)
   04658 Th1 and Th2 cell differentiation
    108397005 (RELA)
   04659 Th17 cell differentiation
    108397005 (RELA)
   04657 IL-17 signaling pathway
    108397005 (RELA)
   04662 B cell receptor signaling pathway
    108397005 (RELA)
   04062 Chemokine signaling pathway
    108397005 (RELA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    108397005 (RELA)
   04917 Prolactin signaling pathway
    108397005 (RELA)
   04926 Relaxin signaling pathway
    108397005 (RELA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    108397005 (RELA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108397005 (RELA)
  09149 Aging
   04211 Longevity regulating pathway
    108397005 (RELA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108397005 (RELA)
   05202 Transcriptional misregulation in cancer
    108397005 (RELA)
   05203 Viral carcinogenesis
    108397005 (RELA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108397005 (RELA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    108397005 (RELA)
   05221 Acute myeloid leukemia
    108397005 (RELA)
   05220 Chronic myeloid leukemia
    108397005 (RELA)
   05215 Prostate cancer
    108397005 (RELA)
   05222 Small cell lung cancer
    108397005 (RELA)
  09163 Immune disease
   05321 Inflammatory bowel disease
    108397005 (RELA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108397005 (RELA)
   05022 Pathways of neurodegeneration - multiple diseases
    108397005 (RELA)
  09165 Substance dependence
   05030 Cocaine addiction
    108397005 (RELA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108397005 (RELA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    108397005 (RELA)
   04931 Insulin resistance
    108397005 (RELA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    108397005 (RELA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108397005 (RELA)
   05135 Yersinia infection
    108397005 (RELA)
   05133 Pertussis
    108397005 (RELA)
   05134 Legionellosis
    108397005 (RELA)
   05152 Tuberculosis
    108397005 (RELA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108397005 (RELA)
   05170 Human immunodeficiency virus 1 infection
    108397005 (RELA)
   05162 Measles
    108397005 (RELA)
   05164 Influenza A
    108397005 (RELA)
   05161 Hepatitis B
    108397005 (RELA)
   05160 Hepatitis C
    108397005 (RELA)
   05168 Herpes simplex virus 1 infection
    108397005 (RELA)
   05163 Human cytomegalovirus infection
    108397005 (RELA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108397005 (RELA)
   05169 Epstein-Barr virus infection
    108397005 (RELA)
   05165 Human papillomavirus infection
    108397005 (RELA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108397005 (RELA)
   05145 Toxoplasmosis
    108397005 (RELA)
   05140 Leishmaniasis
    108397005 (RELA)
   05142 Chagas disease
    108397005 (RELA)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    108397005 (RELA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mjv03000]
    108397005 (RELA)
Transcription factors [BR:mjv03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    108397005 (RELA)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 108397005
NCBI-ProteinID: XP_017515649
LinkDB
Position
Unknown
AA seq 562 aa
MSAAGSAKPTVRALPDLFPLIFPTEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIP
GERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPD
RCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRD
PAGRPLRLSPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVY
FTGPGWEARGSFSQADVHRQVAIVFRTPPYADPGLQAPVRVSMQLRRPSDRELSEPMEFQ
YLPDTDDRHRIEEKRKRTYETFKSIMKKSPFNGPTDPRPPPRRIAVPSRSSTSVPKPATQ
PYPFTPSLSTINFEEFSPMVFPSGQIPSQTSALAPAPAPVLAQAPAPAPAMVSALAQAPA
PGPVLAPGLTQAVAPPAPKTTQAGEGTLTEALLQLQFDDEDLGALLGNSTDPTVFTDLAS
VDNSEFQQLLNQSSVAPHTAEPMLMEYPEAITRLVTGSQRPPDPAPTPLGASGLTNGLIS
GDEDFSSIVDMDFSALLNQISS
NT seq 1689 nt   +upstreamnt  +downstreamnt
atgagtgcagcaggctccgcgaagcccactgtccgtgccctgccagacctgttccccctc
atcttccccaccgagccagcccaggcctctggcccctacgtggagatcatcgagcagccc
aagcagcggggcatgcgctttcgctacaagtgtgagggccgctcggcaggcagtatccca
ggcgagaggagcacggataccaccaagacccaccccaccatcaagatcaatggctacaca
gggccagggacagttcgcatctccctggtcaccaaggacccccctcaccggcctcacccc
catgaacttgtggggaaagactgccgggatggcttctacgaggctgaactctgcccagac
cgctgcatccacagcttccagaacctggggatccagtgtgtgaagaagcgggacctggag
caagccatcagtcagcgcatccagaccaacaacaaccccttccaagttcccatagaagag
cagcgtggagactatgacctaaatgcggtgcggctctgcttccaggtgacagtgcgggac
ccggcagggaggcccctccgcctgtcacctgtcctttctcatcccatctttgacaaccgc
gctcccaacactgctgagctcaagatctgccgagtgaaccgaaactctgggagctgcctt
ggcggagatgaaatcttcctgctgtgtgacaaggtgcagaaagaggacattgaggtgtat
ttcacgggaccaggctgggaggcccgaggttccttttcacaagctgatgttcaccgacaa
gtggccattgtgttccggacacctccctatgcagaccctggcctgcaggcccccgtgcgt
gtctccatgcagctgcggcggccttcagatcgggagcttagcgagcccatggaattccaa
tacttgccagacacagatgatcgtcaccggattgaggagaaacgcaaaaggacatatgag
accttcaagagcatcatgaaaaagagtcctttcaatggacccaccgacccccggcctcca
ccccggcgcattgctgtgccttcccgcagctcaacttccgtccccaagccagcaacccag
ccctatcctttcacgccatccctcagcaccatcaactttgaggagttttcccccatggtc
ttcccttcagggcagatcccaagccagacctcggccttggcaccagcccctgccccagtc
ttggcccaggccccagcccctgccccagccatggtatcggctctggcccaggccccagcc
cctggcccagtactagccccaggcctcactcaggctgtagccccgcctgcccccaagacc
acccaggctggggaagggacactgacagaggccctgctacagctgcagtttgatgatgaa
gacctgggggccctgcttggcaacagcacggacccaaccgtgttcacggacctggcatcc
gtcgacaactctgagtttcagcagctgctgaaccagagttctgtggccccacacacagct
gagcccatgctgatggagtaccccgaggctataactcgcctggtgacagggtcccagagg
ccccctgacccagctcccactcccctgggagcctccgggctcaccaacggcctcatctct
ggggatgaagatttctcctccatcgtggacatggacttctccgcccttctgaatcagatc
agctcctaa

DBGET integrated database retrieval system