KEGG   Manis javanica (Malayan pangolin): 108397041
Entry
108397041         CDS       T06054                                 

Definition
(RefSeq) guanine nucleotide-binding protein G(q) subunit alpha isoform X1
  KO
K04634  guanine nucleotide-binding protein G(q) subunit alpha
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04015  Rap1 signaling pathway
mjv04020  Calcium signaling pathway
mjv04022  cGMP-PKG signaling pathway
mjv04062  Chemokine signaling pathway
mjv04071  Sphingolipid signaling pathway
mjv04261  Adrenergic signaling in cardiomyocytes
mjv04270  Vascular smooth muscle contraction
mjv04371  Apelin signaling pathway
mjv04540  Gap junction
mjv04611  Platelet activation
mjv04713  Circadian entrainment
mjv04720  Long-term potentiation
mjv04723  Retrograde endocannabinoid signaling
mjv04724  Glutamatergic synapse
mjv04725  Cholinergic synapse
mjv04726  Serotonergic synapse
mjv04728  Dopaminergic synapse
mjv04730  Long-term depression
mjv04750  Inflammatory mediator regulation of TRP channels
mjv04911  Insulin secretion
mjv04912  GnRH signaling pathway
mjv04915  Estrogen signaling pathway
mjv04916  Melanogenesis
mjv04918  Thyroid hormone synthesis
mjv04921  Oxytocin signaling pathway
mjv04922  Glucagon signaling pathway
mjv04924  Renin secretion
mjv04925  Aldosterone synthesis and secretion
mjv04927  Cortisol synthesis and secretion
mjv04928  Parathyroid hormone synthesis, secretion and action
mjv04929  GnRH secretion
mjv04934  Cushing syndrome
mjv04935  Growth hormone synthesis, secretion and action
mjv04961  Endocrine and other factor-regulated calcium reabsorption
mjv04970  Salivary secretion
mjv04971  Gastric acid secretion
mjv04972  Pancreatic secretion
mjv05010  Alzheimer disease
mjv05016  Huntington disease
mjv05017  Spinocerebellar ataxia
mjv05022  Pathways of neurodegeneration - multiple diseases
mjv05135  Yersinia infection
mjv05142  Chagas disease
mjv05143  African trypanosomiasis
mjv05146  Amoebiasis
mjv05163  Human cytomegalovirus infection
mjv05170  Human immunodeficiency virus 1 infection
mjv05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    108397041
   04371 Apelin signaling pathway
    108397041
   04020 Calcium signaling pathway
    108397041
   04071 Sphingolipid signaling pathway
    108397041
   04022 cGMP-PKG signaling pathway
    108397041
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    108397041
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    108397041
   04062 Chemokine signaling pathway
    108397041
  09152 Endocrine system
   04911 Insulin secretion
    108397041
   04922 Glucagon signaling pathway
    108397041
   04929 GnRH secretion
    108397041
   04912 GnRH signaling pathway
    108397041
   04915 Estrogen signaling pathway
    108397041
   04921 Oxytocin signaling pathway
    108397041
   04935 Growth hormone synthesis, secretion and action
    108397041
   04918 Thyroid hormone synthesis
    108397041
   04928 Parathyroid hormone synthesis, secretion and action
    108397041
   04916 Melanogenesis
    108397041
   04924 Renin secretion
    108397041
   04925 Aldosterone synthesis and secretion
    108397041
   04927 Cortisol synthesis and secretion
    108397041
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108397041
   04270 Vascular smooth muscle contraction
    108397041
  09154 Digestive system
   04970 Salivary secretion
    108397041
   04971 Gastric acid secretion
    108397041
   04972 Pancreatic secretion
    108397041
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    108397041
  09156 Nervous system
   04724 Glutamatergic synapse
    108397041
   04725 Cholinergic synapse
    108397041
   04728 Dopaminergic synapse
    108397041
   04726 Serotonergic synapse
    108397041
   04720 Long-term potentiation
    108397041
   04730 Long-term depression
    108397041
   04723 Retrograde endocannabinoid signaling
    108397041
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    108397041
  09159 Environmental adaptation
   04713 Circadian entrainment
    108397041
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108397041
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108397041
   05016 Huntington disease
    108397041
   05017 Spinocerebellar ataxia
    108397041
   05022 Pathways of neurodegeneration - multiple diseases
    108397041
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    108397041
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    108397041
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108397041
   05163 Human cytomegalovirus infection
    108397041
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108397041
   05142 Chagas disease
    108397041
   05143 African trypanosomiasis
    108397041
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mjv04147]
    108397041
   04031 GTP-binding proteins [BR:mjv04031]
    108397041
Exosome [BR:mjv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108397041
GTP-binding proteins [BR:mjv04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 3 (Gq/11) [OT]
    108397041
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA TniB AAA_29
Other DBs
NCBI-GeneID: 108397041
NCBI-ProteinID: XP_017515713
LinkDB
Position
Unknown
AA seq 359 aa
MTLESIMACCLSEEAKEARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMR
IIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEK
VSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPAYLPTQQDVL
RVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLV
ESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQR
DAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgactctggagtccatcatggcgtgctgcctgagcgaggaggccaaggaagcccggcgg
atcaacgacgagatagagcggcagctccgcagggacaagcgggacgcccgccgggagctc
aagctgctgctgctcgggacaggagagagcggcaagagtacgttcatcaaacagatgaga
atcatccacggatcaggctactcggatgaggacaaaaggggcttcaccaagctggtgtat
cagaacatcttcacggccatgcaggctatgatcagagccatggacacgctcaagatcccc
tacaagtacgagcacaacaaggctcatgcacaattagttcgagaagttgatgtggagaag
gtgtctgcttttgagaatccatatgtagatgcaataaagagtttatggaatgatcctgga
atccaggaatgctatgatagacgacgagaatatcaattatctgactctaccaaatactat
cttaatgacttggaccgcgttgctgaccctgcctacctgcctacacagcaagacgtgctt
agagttcgagtccccaccacagggatcatcgagtacccctttgacttacaaagtgtcatt
ttcagaatggtcgatgtagggggccaaaggtcagagagaagaaaatggatacactgcttt
gaaaatgtcacctctatcatgtttctagtagcgcttagtgaatatgatcaagttctcgtg
gagtcggacaatgagaaccgaatggaggaaagcaaagcactctttagaacaattatcaca
tatccctggttccagaactcctcggttattctcttcttaaacaagaaagatcttctagag
gagaaaattatgtattcgcacctagttgactacttcccagaatatgatggaccccagaga
gatgcccaggcagctcgagaattcattctgaagatgttcgtggacctgaacccagacagt
gacaaaatcatctactcccacttcacctgcgccacagacaccgagaacatccgctttgtt
tttgccgccgtcaaggacaccatcctccagctgaacctgaaggagtacaatctggtctga

DBGET integrated database retrieval system