KEGG   Manis javanica (Malayan pangolin): 108397044
Entry
108397044         CDS       T06054                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase, inducible isoform X1
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv00220  Arginine biosynthesis
mjv00330  Arginine and proline metabolism
mjv01100  Metabolic pathways
mjv04020  Calcium signaling pathway
mjv04066  HIF-1 signaling pathway
mjv04146  Peroxisome
mjv04371  Apelin signaling pathway
mjv04926  Relaxin signaling pathway
mjv05010  Alzheimer disease
mjv05014  Amyotrophic lateral sclerosis
mjv05022  Pathways of neurodegeneration - multiple diseases
mjv05133  Pertussis
mjv05140  Leishmaniasis
mjv05142  Chagas disease
mjv05145  Toxoplasmosis
mjv05146  Amoebiasis
mjv05152  Tuberculosis
mjv05200  Pathways in cancer
mjv05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    108397044 (NOS2)
   00330 Arginine and proline metabolism
    108397044 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    108397044 (NOS2)
   04066 HIF-1 signaling pathway
    108397044 (NOS2)
   04020 Calcium signaling pathway
    108397044 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    108397044 (NOS2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    108397044 (NOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108397044 (NOS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    108397044 (NOS2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108397044 (NOS2)
   05014 Amyotrophic lateral sclerosis
    108397044 (NOS2)
   05022 Pathways of neurodegeneration - multiple diseases
    108397044 (NOS2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    108397044 (NOS2)
   05152 Tuberculosis
    108397044 (NOS2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108397044 (NOS2)
   05145 Toxoplasmosis
    108397044 (NOS2)
   05140 Leishmaniasis
    108397044 (NOS2)
   05142 Chagas disease
    108397044 (NOS2)
Enzymes [BR:mjv01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     108397044 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 NAD_binding_6
Other DBs
NCBI-GeneID: 108397044
NCBI-ProteinID: XP_017515720
LinkDB
Position
Unknown
AA seq 1143 aa
MACPWKFLFKAKSYQYDMTEKTDINNNVGKATQAPSSPVTQDDPKCHSLSKHQNECPQCL
SGTTKASPESLVKLDVPPSTGPQHVRIKNWHNGMTFQDTLYHKAKRDIHCKTKSCLGAIM
NPRSMTRGPRDKPTPPDELLPQAIEFVNQYYSSFKEAKIEEHLARLEAVTKEIETTGTYQ
LTGDELIFAAKQAWRNAPRCIGRIQWSNLQVFDARSCSTAQEMFEHICRHLRYATNSGNI
RSAITVFPQRSDGKHDFRVWNAQLIRYAGYQMPDGTIRGDPASVEFTQLCIDLGWKPKYG
RFDVVPLVLQADGRDPELFEIPPDLVLEVPMDHPKYEWFQELELKWYALPAVANMLLEAG
GLEFPGCPFNGWYMGTEIGVRDFCDVQRYNILEEVGRRMGLDTYKLASLWKDRAVIEINV
AVLHSFQKQNVTIMDHHSAAESFMKYMQNEYRSRGGCPADWVWLVPPISGSITPVFHQEM
LNYVLSPFYYYQVEAWKTHIWKDEKLRPWKREIQFKVLVKAVLFTSVLMRKTMASRVRAT
ILFATETGKSETLARDLGNLFSCAFNPKVLCMDEYRLSNLEEEQLLLVVTSTFGNGDSPG
NGEKLKKSLFVLKELTNKFRYAVFGLGSSMYPQFCAFAHDIDQKLSQLGASQLTLTGEGD
ELSGQEEAFRSWAVQTFKAACETFSVQGRHCIQIPKLYTSDVTWDPHHYRLVQDSQPLDL
NKALGSMHAKTVFTLRLKSRQNLQSPKSSRTTLLVKLSCEGSQGLSYLPGEHLGVFPGNQ
PALVQAVLGRVLDGPAPHQPVRLETLGENGRYWVGDKRLPPCSLSQALTYFLDITTPPTQ
LLLRKLAQLATEEAEKQRLETLCQPSEYSRWKLSDSPTFPELLEQFPSLQVPASFLLSQL
PLLRPRYYSISSSRDRTPSEVHLTVAVLVYRTRDGQGPLHHGVCSTWLNNLKPQDPVPCF
VRSANGFQLPEDPSHPCILIGPGTGIAPFRSFWQQRLHDVQHKGLQGSRLTLVFGCRRPD
EDHIYKEEMLEMARNGVLHEVHTAYSRLPGQPKVYVQDILRQQLASEVLHVLHEEQGHLY
VCGDVRMARDVAQTLKQLVAAKLSLSEEQVEDYFFQLKSQKRYHEDIFGAVFPYEVKKGG
ASQ
NT seq 3432 nt   +upstreamnt  +downstreamnt
atggcctgtccctggaagttcctgttcaaggccaaatcctaccagtatgacatgactgag
aaaacggacatcaacaacaatgtgggaaaggccacccaggctccctccagtccagtgaca
caggatgaccccaagtgtcacagcctcagcaagcaccagaatgagtgcccccagtgtctc
tcggggaccacaaaggcatctccagaatccctggtcaagctggatgtgcccccatcgact
ggcccacagcatgtgaggatcaaaaactggcacaatgggatgactttccaagacactctt
taccacaaggccaagagggacatccattgcaagaccaagtcttgcctgggagccatcatg
aaccccagaagcatgaccagaggacccagggataagcctactcctccagatgagcttcta
cctcaagctatcgaatttgtcaaccagtattacagctccttcaaagaagcaaaaatagag
gaacatctggccaggctggaggcagtaacaaaggagatagaaacaacaggaacctaccag
ctgacgggagatgagctcatctttgccgccaagcaggcctggcgcaatgccccccgctgc
attgggaggatccagtggtccaacctgcaggtcttcgatgcccggagctgttccactgcc
caggaaatgtttgagcacatctgcaggcacctgcggtacgctaccaacagcggcaacatc
aggtcggctatcacagtgttcccccagcggagtgatgggaaacacgacttccgggtctgg
aatgctcagcttatccggtatgctggctaccagatgcctgacggcaccatcagaggggac
cctgcctcggtggagttcacccagctgtgcatcgacctgggttggaagcccaagtatggt
cgctttgatgtggtgcctctggtccttcaggctgatggccgtgaccctgagctcttcgag
atcccacctgacctcgtgcttgaggtgcccatggaccatcccaagtacgagtggttccag
gagctggagctgaagtggtatgccctgcctgccgtggccaacatgctgctcgaggcgggt
ggccttgagtttccagggtgccccttcaatggctggtacatgggcacggagatcggggtc
cgggacttctgtgatgtccagcgctacaacatcttggaggaagtgggtagaaggatgggc
ctggacacgtacaaactggcgtcactctggaaagaccgggctgtcattgagattaatgtc
gctgtgcttcacagttttcagaagcaaaatgtgaccatcatggaccaccactcagccgca
gagtccttcatgaagtacatgcagaatgagtaccggtcccgggggggctgcccagctgac
tgggtttggctggtccccccgatttctggcagcatcacccctgtgttccatcaggagatg
ttaaactatgtcctgtcccctttctattactaccaggtggaggcctggaaaacccacatc
tggaaggatgagaagctgagaccctggaaaagagagattcaattcaaagtcttggttaaa
gccgtgcttttcacctcagtgctgatgcgcaagaccatggcgtcccgagtgagagccacc
atcctctttgccaccgagacgggaaaatcagaaaccctggcccgggacctagggaacctg
ttcagctgcgccttcaaccccaaggttctctgcatggatgagtacaggctgagcaacctg
gaggaggagcagcttctgctcgtggtgaccagcacgtttgggaatggagactcccccggc
aatggcgagaaactgaagaaatccctcttcgtgctgaaggagctcactaacaagttcagg
tatgctgtgtttgggctcggctccagcatgtaccctcagttctgcgcctttgctcatgac
attgaccagaagctgtcccagctgggtgcctcccagctcaccctgacaggggaaggggat
gagctcagtgggcaggaggaggccttccgcagctgggctgtgcaaaccttcaaggcagcc
tgtgagacgttcagtgtccaaggcagacactgcatccagatccccaagctctacacctcc
gatgtgacctgggacccgcaccactacaggctcgtgcaggactcacagcctttggacctc
aacaaagccctcggcagcatgcatgccaagacggtgttcaccttgaggctcaagtcgagg
cagaatctacagagtccaaaatccagccgtaccaccctcctggtgaaactctcctgtgag
ggcagccaaggtctgagctacctgcctggagagcacctcggggttttcccaggcaaccag
ccggccctggtccaagccgtcctggggagagtgctggatggccctgcaccccaccaacct
gtgcgcctggagaccctgggcgagaacggcagatactgggtgggggacaagcggctgccc
ccctgctcactcagccaggccctcacctacttcctggacatcaccaccccgccaacccag
ctgctgctccgaaagctggcccagctggccaccgaggaggcggagaagcagaggctggag
accctgtgccagccctcggagtacagccggtggaagctcagcgacagccccacgttcccg
gagctgctggagcagttcccgtccctgcaggtgcctgccagcttcctgctctcgcagctc
ccgctcctgcggccccggtactactccatcagctcctccagggaccgcacgccgtcggag
gtgcacctcaccgtggctgtgctcgtgtaccgcacccgagatggccagggtcccctgcac
catggtgtctgcagcacttggctcaacaacctgaagccccaagacccagtgccctgcttt
gtgcgaagtgccaatggcttccagctcccggaagacccctcccatccttgcatcctcatc
gggccaggcacgggcatcgcccccttccgcagcttctggcagcagcgactccatgatgtc
cagcacaaagggcttcagggcagccgcctgacgctggtgtttgggtgccgccgcccggat
gaggaccacatctataaggaggagatgttggagatggcccggaatggggtgctgcatgag
gtgcacacagcctattctcgcctgcctggccagcccaaggtgtatgttcaggacatcctg
aggcagcagctggccagtgaggtgctccacgtgctccacgaggagcaaggccacctctac
gtctgtggggatgtgcgtatggcccgggatgtggcccaaaccctgaagcagctggtggct
gcaaagctgagcctgagtgaggagcaggtcgaggactatttcttccagcttaagagccag
aagcgctaccatgaagacatctttggtgctgtatttccctatgaggtgaaaaagggtggg
gcatcccagtga

DBGET integrated database retrieval system