KEGG   Manis javanica (Malayan pangolin): 108397345
Entry
108397345         CDS       T06054                                 

Gene name
ADCY3
Definition
(RefSeq) adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv00230  Purine metabolism
mjv01100  Metabolic pathways
mjv01522  Endocrine resistance
mjv04015  Rap1 signaling pathway
mjv04020  Calcium signaling pathway
mjv04022  cGMP-PKG signaling pathway
mjv04024  cAMP signaling pathway
mjv04062  Chemokine signaling pathway
mjv04072  Phospholipase D signaling pathway
mjv04114  Oocyte meiosis
mjv04211  Longevity regulating pathway
mjv04213  Longevity regulating pathway - multiple species
mjv04261  Adrenergic signaling in cardiomyocytes
mjv04270  Vascular smooth muscle contraction
mjv04371  Apelin signaling pathway
mjv04540  Gap junction
mjv04611  Platelet activation
mjv04713  Circadian entrainment
mjv04714  Thermogenesis
mjv04723  Retrograde endocannabinoid signaling
mjv04724  Glutamatergic synapse
mjv04725  Cholinergic synapse
mjv04727  GABAergic synapse
mjv04740  Olfactory transduction
mjv04750  Inflammatory mediator regulation of TRP channels
mjv04911  Insulin secretion
mjv04912  GnRH signaling pathway
mjv04913  Ovarian steroidogenesis
mjv04914  Progesterone-mediated oocyte maturation
mjv04915  Estrogen signaling pathway
mjv04916  Melanogenesis
mjv04918  Thyroid hormone synthesis
mjv04921  Oxytocin signaling pathway
mjv04923  Regulation of lipolysis in adipocytes
mjv04925  Aldosterone synthesis and secretion
mjv04926  Relaxin signaling pathway
mjv04927  Cortisol synthesis and secretion
mjv04928  Parathyroid hormone synthesis, secretion and action
mjv04934  Cushing syndrome
mjv04935  Growth hormone synthesis, secretion and action
mjv04962  Vasopressin-regulated water reabsorption
mjv04970  Salivary secretion
mjv04971  Gastric acid secretion
mjv04972  Pancreatic secretion
mjv04976  Bile secretion
mjv05032  Morphine addiction
mjv05163  Human cytomegalovirus infection
mjv05166  Human T-cell leukemia virus 1 infection
mjv05200  Pathways in cancer
mjv05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    108397345 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    108397345 (ADCY3)
   04371 Apelin signaling pathway
    108397345 (ADCY3)
   04020 Calcium signaling pathway
    108397345 (ADCY3)
   04072 Phospholipase D signaling pathway
    108397345 (ADCY3)
   04024 cAMP signaling pathway
    108397345 (ADCY3)
   04022 cGMP-PKG signaling pathway
    108397345 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    108397345 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    108397345 (ADCY3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    108397345 (ADCY3)
   04062 Chemokine signaling pathway
    108397345 (ADCY3)
  09152 Endocrine system
   04911 Insulin secretion
    108397345 (ADCY3)
   04923 Regulation of lipolysis in adipocytes
    108397345 (ADCY3)
   04912 GnRH signaling pathway
    108397345 (ADCY3)
   04913 Ovarian steroidogenesis
    108397345 (ADCY3)
   04915 Estrogen signaling pathway
    108397345 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    108397345 (ADCY3)
   04921 Oxytocin signaling pathway
    108397345 (ADCY3)
   04926 Relaxin signaling pathway
    108397345 (ADCY3)
   04935 Growth hormone synthesis, secretion and action
    108397345 (ADCY3)
   04918 Thyroid hormone synthesis
    108397345 (ADCY3)
   04928 Parathyroid hormone synthesis, secretion and action
    108397345 (ADCY3)
   04916 Melanogenesis
    108397345 (ADCY3)
   04925 Aldosterone synthesis and secretion
    108397345 (ADCY3)
   04927 Cortisol synthesis and secretion
    108397345 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108397345 (ADCY3)
   04270 Vascular smooth muscle contraction
    108397345 (ADCY3)
  09154 Digestive system
   04970 Salivary secretion
    108397345 (ADCY3)
   04971 Gastric acid secretion
    108397345 (ADCY3)
   04972 Pancreatic secretion
    108397345 (ADCY3)
   04976 Bile secretion
    108397345 (ADCY3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    108397345 (ADCY3)
  09156 Nervous system
   04724 Glutamatergic synapse
    108397345 (ADCY3)
   04727 GABAergic synapse
    108397345 (ADCY3)
   04725 Cholinergic synapse
    108397345 (ADCY3)
   04723 Retrograde endocannabinoid signaling
    108397345 (ADCY3)
  09157 Sensory system
   04740 Olfactory transduction
    108397345 (ADCY3)
   04750 Inflammatory mediator regulation of TRP channels
    108397345 (ADCY3)
  09149 Aging
   04211 Longevity regulating pathway
    108397345 (ADCY3)
   04213 Longevity regulating pathway - multiple species
    108397345 (ADCY3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    108397345 (ADCY3)
   04714 Thermogenesis
    108397345 (ADCY3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108397345 (ADCY3)
  09165 Substance dependence
   05032 Morphine addiction
    108397345 (ADCY3)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    108397345 (ADCY3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    108397345 (ADCY3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108397345 (ADCY3)
   05163 Human cytomegalovirus infection
    108397345 (ADCY3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    108397345 (ADCY3)
Enzymes [BR:mjv01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     108397345 (ADCY3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA
Other DBs
NCBI-GeneID: 108397345
NCBI-ProteinID: XP_017516195
LinkDB
Position
Unknown
AA seq 1145 aa
MPRNQGFSEPEYSAEYSAEYSVSLPSDPDRGVGRTHEISVRNSGSCLCLPRFMRLTFVPE
SLENLYQTYFKRQRHETLLVLVVFAALFDCYVVLMCAVVFSSDKLAPLIVAGIGLLLDII
LFVLCKKGLLPTRVTRKVVPYFLWLLITAQIFSYLGLNFAGAHAASDTVGWQAFFVFSFF
ITLPLSLSPIVIISVVSCVVHTLVLGVTVAQQQQDGLKGIQLLREILANVFLYLCAITVG
IMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLMLSILPKHVADEMLKDMKKDES
QKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFDVEPGDGGSRCD
YLDEKGIETYLIIASKPEVKKTATQNGLNGLALPNGAPASSKPSSPALIETKEPNGSAHN
TGSSSEEPEEPGAQADTPAFPNPRRRLRLQDLADRVVDASEDEHELNQLLSEALLERESA
QEVKKRNTFLLSMRFMDPEMETRYSVEKEKQSGAAFSCSCVVLLCTALVETLIDPWLMTN
YVTFVVGEALLLILTICSLAAIFPRAFPKKLVAFSTWIDRTRWARNTWAMLAIFILVMAN
VVDMLSCLQYYTGPSNGTTAMQVEDGCMENPKYYSYVAVLSLIATIMLVQVSHMVKLTLM
LLVSGAVAVINIYAWCPIFDEYDRKRFQEHDFPVVTLEKMQVFLTPGLNGTNRLPLMPSK
YSMTVMIFIVMLSLYYFSRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVANMLPEH
VARHFLGSKKRDEELYSQSYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDF
DSLLDNPKFRVITKIKTIGSTYMAASGVTPDVNTNGFTSSNKEEKSDKERWQHLADLADF
ALAMKDTLTNINNQSFNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGV
MGNIQVVEETQVILREYGFRFVKRGPIFVKGKGELLTFFLKGREKPAAFPNGSSVTLPHQ
VVDNS
NT seq 3438 nt   +upstreamnt  +downstreamnt
atgccgcggaaccagggcttctctgagcccgagtactcggcagagtactccgccgagtac
tctgtcagcctgccctctgacccagaccgcggggtgggccggacccatgaaatctctgtc
cggaactcgggatcctgtctgtgcctgcctcgcttcatgcggctcaccttcgtgcctgag
tccttggagaacctgtaccagacctacttcaaaagacagcgccacgagaccctgctggtg
ctggtggtcttcgcagctctcttcgactgctacgtggtgctcatgtgcgctgtagtcttc
tcgagcgacaagctggctcccctcatcgtggccggcatcgggctgctgttggacatcatc
ctcttcgtgctctgcaaaaaggggctgctccccacccgggttacccggaaagtggtgccc
tacttcctgtggctgctgataacagcccagattttttcctacctgggcctgaacttcgct
ggcgcccatgcggccagtgacacggtgggctggcaggccttctttgtcttctctttcttc
atcacgctgcccctcagcctcagccccattgtcatcatctctgtggtctcttgtgttgtc
cacacacttgtcttgggggtaactgtggcccagcagcagcaggatgggctgaaggggata
cagttgctgagggagatcctggccaatgtcttcctgtacctctgcgccatcactgtgggc
atcatgtcctactacatggcggaccgcaagcaccgcaaggccttcctggaagcccggcag
tcgctggaggtgaagatgaacctggaggagcagagccaacagcaggagaaccttatgctt
tccatcctgcccaagcacgtggccgacgagatgttgaaggatatgaagaaagatgagagc
cagaaggaccagcagcagttcaacaccatgtacatgtaccgccatgagaacgtcagcatc
ctctttgcagacatcgtgggcttcacccagctgtcttctgcctgtagtgcccaggagctc
gtgaagctgctcaacgagctcttcgcccgcttcgacaagctggcggccaaataccaccaa
ctgcggattaagatcctgggtgactgctactactgcatctgtggcctgcccgactaccgg
gaggaccacgcggtctgctccatcctcatggggcttgccatggtggaggccatctcgtat
gtgcgggagaagacgaagaccggggtagacatgcgcgtgggggtgcacacgggcactgtg
ctgggaggcgtcttgggccagaagcgctggcagtatgacgtgtggtctaccgacgtcact
gtggccaacaaaatggaagccggcggcatccctgggcgtgtgcacatctcccagagcacc
atggactgtctgaagggggagtttgacgtggagcctggcgatgggggcagccgttgcgat
tacctagatgagaagggcattgaaacctacctcatcattgcatccaagccagaggtgaag
aaaacagccacccaaaatggactcaatggcttggccctgccgaatggagcaccagcttcc
tcaaagcccagctcccctgccctcatcgagaccaaggagcctaatgggagcgcccacaac
actggttcttcctcagaggagcctgaggaaccaggtgcccaggctgacacccccgccttc
cccaatccacgccggaggctgcgcctgcaggacctggcagacagagtggtggacgcctct
gaggatgagcatgagctcaaccagctgctcagcgaagccctgctcgagcgggagtctgcc
caggaagtgaagaagagaaacaccttcctcctatccatgcggttcatggaccctgagatg
gaaactcgttactcggtggagaaggaaaagcagagcggggcggccttcagctgctcctgc
gtggtcctgctctgtacggccctggtggagacactcatcgacccctggctgatgacaaac
tatgtgaccttcgtggttggggaggctctgctgctgatcctgacgatctgctccctggct
gccatcttcccccgggcctttcccaagaagcttgtggccttctcaacttggatcgaccgg
acccgctgggccaggaacacctgggccatgttagccatcttcattctggtgatggcgaac
gtcgtggacatgcttagctgcctccagtactacacaggccccagcaacggcactacagcg
atgcaggtggaggatggctgcatggagaaccccaagtattacagctatgtcgctgtgctg
tccctcatcgccaccatcatgctggtgcaggtcagccacatggtgaagctcacgctcatg
ctgcttgtgtcgggtgctgtggccgtcatcaacatctatgcctggtgccccatctttgat
gaatacgaccgcaaacgtttccaggaacatgactttcctgtagtcactttagagaagatg
caggtatttctcacccctgggctcaacggcactaacaggctgcccctgatgccttcgaag
tactccatgacagtgatgatcttcatcgtgatgctgagcttgtactacttctcccgccac
gtggaaaaactggcacggacactgttcttatggaagattgaggtccatgaccagaaggaa
cgtgtctacgagatgcgacgctggaacgaagccttggtggccaacatgctgccagagcac
gtggcacgccacttcttggggtccaagaagagagatgaggagctgtatagccagtcttac
gatgagattggagtcatgtttgcctccctgcccaactttgctgacttctacacagaagag
agcatcaataatggtggcattgaatgtctgcgcttcctcaatgagatcatctcagatttt
gactctctcctggacaatcccaaattccgggtcatcaccaagatcaaaaccattggcagc
acctatatggcagcttcaggagtcaccccagatgtcaacaccaacggctttaccagctcc
aacaaggaggaaaagtcagacaaggagcgctggcagcacctggctgatctggcggacttc
gcactggccatgaaggacacacttaccaacatcaacaaccagtctttcaacaacttcatg
ctgcgtataggcatgaacaaaggaggggtactggctggtgtcattggagcccggaaacca
cactatgacatctggggcaatacagtcaatgtagccagcaggatggagtccacaggggtc
atgggcaacattcaggtggtagaagaaacacaagtcatccttcgagagtacggcttccgc
tttgtgaaaagaggacccatcttcgtgaaagggaagggagagctgctcacctttttcttg
aagggccgtgagaagccagctgccttccctaatggctcctctgtgacactgccccaccag
gtggtagacaactcctaa

DBGET integrated database retrieval system