KEGG   Manis javanica (Malayan pangolin): 108397360
Entry
108397360         CDS       T06054                                 

Gene name
PDGFB
Definition
(RefSeq) platelet-derived growth factor subunit B isoform X1
  KO
K17386  platelet-derived growth factor subunit B
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01521  EGFR tyrosine kinase inhibitor resistance
mjv04010  MAPK signaling pathway
mjv04014  Ras signaling pathway
mjv04015  Rap1 signaling pathway
mjv04020  Calcium signaling pathway
mjv04072  Phospholipase D signaling pathway
mjv04151  PI3K-Akt signaling pathway
mjv04510  Focal adhesion
mjv04540  Gap junction
mjv04630  JAK-STAT signaling pathway
mjv04810  Regulation of actin cytoskeleton
mjv05167  Kaposi sarcoma-associated herpesvirus infection
mjv05200  Pathways in cancer
mjv05206  MicroRNAs in cancer
mjv05211  Renal cell carcinoma
mjv05214  Glioma
mjv05215  Prostate cancer
mjv05218  Melanoma
mjv05231  Choline metabolism in cancer
mjv05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108397360 (PDGFB)
   04014 Ras signaling pathway
    108397360 (PDGFB)
   04015 Rap1 signaling pathway
    108397360 (PDGFB)
   04630 JAK-STAT signaling pathway
    108397360 (PDGFB)
   04020 Calcium signaling pathway
    108397360 (PDGFB)
   04072 Phospholipase D signaling pathway
    108397360 (PDGFB)
   04151 PI3K-Akt signaling pathway
    108397360 (PDGFB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108397360 (PDGFB)
   04540 Gap junction
    108397360 (PDGFB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108397360 (PDGFB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108397360 (PDGFB)
   05206 MicroRNAs in cancer
    108397360 (PDGFB)
   05231 Choline metabolism in cancer
    108397360 (PDGFB)
  09162 Cancer: specific types
   05214 Glioma
    108397360 (PDGFB)
   05218 Melanoma
    108397360 (PDGFB)
   05211 Renal cell carcinoma
    108397360 (PDGFB)
   05215 Prostate cancer
    108397360 (PDGFB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108397360 (PDGFB)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    108397360 (PDGFB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108397360 (PDGFB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mjv04052]
    108397360 (PDGFB)
   00536 Glycosaminoglycan binding proteins [BR:mjv00536]
    108397360 (PDGFB)
Cytokines and growth factors [BR:mjv04052]
 Growth factors
  Growth factors (RTK binding)
   108397360 (PDGFB)
Glycosaminoglycan binding proteins [BR:mjv00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   108397360 (PDGFB)
SSDB
Motif
Pfam: PDGF PDGF_N
Other DBs
NCBI-GeneID: 108397360
NCBI-ProteinID: XP_017516225
LinkDB
Position
Unknown
AA seq 242 aa
MNRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHAIRSFDDLQRLLHGDSVGEDGAGL
DLNVTRPHSGGELESLPRGRRSLGSPTVAEPAMIAECKTRTEVFEISRRLIDRTNANFLV
WPPCVEVQRCSGCCNNRNVQCRPTQVQLRHVQVRKIEIVRKKPTFKKATVTLEDHLACKC
ETVVAARPVTRSPGNSQDQRAARTPQTRVTIRTVRVRRPPKGKHRKFKHTHDKMALKETL
GA
NT seq 729 nt   +upstreamnt  +downstreamnt
atgaatcgctgctgggcgctcttcctgtctctctgctgctacctgcgtctggtcagcgcc
gagggggaccccattccagaggagctctatgagatgctgagtgaccacgcaatccgctcc
ttcgatgacctccagcgcctgctgcatggagactccgtaggtgaagacggggctgggctg
gacctaaatgtgacccggccccattctggaggcgagctggagagcttaccccgtgggagg
aggagcctaggttccccgacggttgctgagccagccatgatcgctgagtgcaagacccgc
accgaggtgtttgagatctcccggcgcctcatagaccgcaccaacgccaacttcctggtg
tggccgccctgcgtggaggtgcagcgctgctctggctgctgcaacaaccgcaacgtgcag
tgccgccccacccaggtgcagctgcggcacgttcaggtgagaaagatcgagattgtgcgg
aagaagccgacctttaaaaaggccacggtgaccctggaggaccacttggcgtgcaagtgt
gagacagtggtggctgcacgacccgtgacccgaagcccggggaattcccaggaccagcga
gcagcgaggacgccccaaactcgggtgaccattaggacagtgcgggtccgccgacccccc
aaggggaagcaccggaaattcaagcacacacatgacaagatggcactgaaggagaccctc
ggagcctag

KEGG   Manis javanica (Malayan pangolin): 108408073
Entry
108408073         CDS       T06054                                 

Gene name
EGF
Definition
(RefSeq) pro-epidermal growth factor isoform X1
  KO
K04357  epidermal growth factor
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01521  EGFR tyrosine kinase inhibitor resistance
mjv04010  MAPK signaling pathway
mjv04012  ErbB signaling pathway
mjv04014  Ras signaling pathway
mjv04015  Rap1 signaling pathway
mjv04020  Calcium signaling pathway
mjv04066  HIF-1 signaling pathway
mjv04068  FoxO signaling pathway
mjv04072  Phospholipase D signaling pathway
mjv04151  PI3K-Akt signaling pathway
mjv04510  Focal adhesion
mjv04540  Gap junction
mjv04630  JAK-STAT signaling pathway
mjv04810  Regulation of actin cytoskeleton
mjv05160  Hepatitis C
mjv05165  Human papillomavirus infection
mjv05200  Pathways in cancer
mjv05210  Colorectal cancer
mjv05212  Pancreatic cancer
mjv05213  Endometrial cancer
mjv05214  Glioma
mjv05215  Prostate cancer
mjv05218  Melanoma
mjv05219  Bladder cancer
mjv05223  Non-small cell lung cancer
mjv05224  Breast cancer
mjv05226  Gastric cancer
mjv05231  Choline metabolism in cancer
mjv05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108408073 (EGF)
   04012 ErbB signaling pathway
    108408073 (EGF)
   04014 Ras signaling pathway
    108408073 (EGF)
   04015 Rap1 signaling pathway
    108408073 (EGF)
   04630 JAK-STAT signaling pathway
    108408073 (EGF)
   04066 HIF-1 signaling pathway
    108408073 (EGF)
   04068 FoxO signaling pathway
    108408073 (EGF)
   04020 Calcium signaling pathway
    108408073 (EGF)
   04072 Phospholipase D signaling pathway
    108408073 (EGF)
   04151 PI3K-Akt signaling pathway
    108408073 (EGF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108408073 (EGF)
   04540 Gap junction
    108408073 (EGF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108408073 (EGF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108408073 (EGF)
   05231 Choline metabolism in cancer
    108408073 (EGF)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108408073 (EGF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108408073 (EGF)
   05212 Pancreatic cancer
    108408073 (EGF)
   05226 Gastric cancer
    108408073 (EGF)
   05214 Glioma
    108408073 (EGF)
   05218 Melanoma
    108408073 (EGF)
   05219 Bladder cancer
    108408073 (EGF)
   05215 Prostate cancer
    108408073 (EGF)
   05213 Endometrial cancer
    108408073 (EGF)
   05224 Breast cancer
    108408073 (EGF)
   05223 Non-small cell lung cancer
    108408073 (EGF)
  09172 Infectious disease: viral
   05160 Hepatitis C
    108408073 (EGF)
   05165 Human papillomavirus infection
    108408073 (EGF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108408073 (EGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mjv04052]
    108408073 (EGF)
Cytokines and growth factors [BR:mjv04052]
 Growth factors
  Growth factors (RTK binding)
   108408073 (EGF)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition cEGF EGF_CA EGF DUF5050 EGF_3 SGL hEGF
Other DBs
NCBI-GeneID: 108408073
NCBI-ProteinID: XP_017533297
LinkDB
Position
Unknown
AA seq 1246 aa
MLLFFIILLPVVFKFTSVSPSALELWNCPDGSPSGNGNSACVDMKIRRDKCWAMELPPGE
ELFSRISAGRGCGGAGPAPFLIFSHGNSIFRIDLEGTNHEQLVANAGISVIMDFHYNKER
LYWVDTERQLLQRVFMNGTRQERVCTIEKNVSGMAVNWINEELIWSNQQEGIITVTDMKG
NNSRVLLSTLKYPANVAVDPVERFIFWCSEEAGSLHRADLSGVAAKVLLETSQKVTAVSL
DVSEKRLFWIQYNREGSKSRLYSCDYDGDSVHFSQHLTQHNLFAMSLFGDRIIYSAWKKK
TIWIANKHTGMDMVRMNLNASSLPPGGVKVVHSLVQPKAEGSATVSDQKQCTLRKGNCRG
SICGRDPKSHSCMCAEGYTLSQDGKYCEDVNECAFWNHGCTLGCENIPGSYYCTCPVGFV
LLPDGKRCHQLISCPSNVSECSHDCVLTSDGPVCFCPEGSVLETDGKMCSGCSSPDNGGC
SQLCLALSPASWECGCFPGYDLQADRKSCTASVGPQPFLLFANSQDIRHMNFDGTDYGTV
LSQQMGKVFALDHDPVENKIYFAHTALKWIERANMDGSQRERLIEAVDVPEGLAVDWSGR
RLYWTDKGKSLIEGSDLTGKHREIIIKEGISQPRGIAVHPVAKRLFWTDMGINPRIESAS
LQGIGRLVIASSDLVWPSGITIDYLTDKLYWCDAKRSVIEMANLDGSKRQRLAQNDVGHP
FAVAVFEDHVWFSDWTMPSVIRVNKRTGKNRVRLRGSMLKPSSLVVVHPLAKPGAEPCFH
RNGGCEHICEERFGTARCSCREGFVKAPDGKMCLAVNGHQISAGNEAGLNNQVTPLDILS
RTGDFGDNITESPPMLVAEIMVSDDDDCGPVGCSRQAQCVSEGADDATCQCLKGFAGDGK
LCSDIDECEVSVTVCPPTSKCINTEGGYVCRCSEGYRGDGIHCLDIDECQLGTHTCGKNS
TCTNTVGNYTCVYSSSLSELGRICPDSTPPSLLGADGHYSVRNSYKECPPSHDGYCLNDG
VCIYIEEVDSYACRCAVGFVGDRCQYRDLRWELRHAGHGRQRNVTVAAACVVALVLMLVL
GLCGAHYYRTQKMLSENLKNPYEESSREESGSRPADSEAGMSSCPQPWFVVLKEHENLRN
GSQPVALKDGQVADVGQLSSLEPGLVQAVSWVKKPQMCMGTEHRHCLPLPSDTGSYPQAV
GCSCRLPSCGAQPTAVEVGKPHFLLSANPSWQQRPLDPPHQMEPTQ
NT seq 3741 nt   +upstreamnt  +downstreamnt
atgctgctcttctttatcattctgttgcctgtagtttttaagtttacttccgtcagtccc
tcagcactggagctctggaactgtcctgatggctctccctcggggaatgggaattctgct
tgtgtggacatgaagatccgcagagacaagtgctgggctatggagctaccacctggagag
gagctgttttcccgtatctcggccggaaggggctgtggaggcgcaggtcctgcacccttc
ttaattttctcccatggaaacagtatcttcagaattgacctggaaggaactaatcatgag
caattagtggcaaatgctggcatatcggtgatcatggattttcattacaataaggaaaga
ctctattgggtagatacagaaagacagcttctacagagagtttttatgaatgggacaagg
caagagagagtatgcactatagagaaaaatgtttcaggaatggcagtaaattggataaat
gaggaacttatttggtcaaatcaacaagaaggaatcattactgtaacagatatgaaagga
aacaattcccgtgttctcttaagtactttgaaatatcctgcaaatgtagcagttgatcca
gtagaaaggtttatattttggtgttcggaggaggccggcagccttcacagagcagatctc
agtggtgtggccgcgaaggttctgttggagacgtcacagaaagtaactgccgtgtcattg
gatgtgtccgagaaacggctcttttggattcagtataacagagagggaagcaaatctcgt
ctgtattcctgtgattatgatggcgattctgtccatttcagccaacatcttacacagcac
aatttgtttgcgatgtccctttttggtgaccgtataatctattcagcatggaaaaagaag
acgatttggatagctaacaagcacactgggatggatatggttagaatgaacctcaatgca
tcatctttaccccctggtggagttaaagtagtgcattccctcgtacagcccaaggcagag
ggcagtgctacagtgtctgatcagaaacagtgcacactgaggaaaggtaactgcagaggc
agcatatgtgggcgagaccccaagtcccactcgtgcatgtgtgcagagggatatacttta
agccaagatggaaagtactgtgaagatgtcaatgaatgtgccttttggaatcatggctgt
actcttgggtgtgaaaacatccctggatcctattattgcacatgtcctgtgggatttgtt
ctgcttcctgatgggaaacggtgtcaccaattaatttcctgtccaagcaatgtgtctgaa
tgcagccatgactgtgtgctgacctcagacggtcctgtatgcttctgtcctgaaggctca
gtgcttgagacagatggaaagatgtgtagtggctgttcctctcctgacaacggtggctgc
agccagctctgcctcgctctcagcccagcatcctgggaatgtggctgctttcctgggtat
gacctgcaggcggaccggaaaagctgtacagcctcagtaggaccacagccgtttttgctg
tttgccaattctcaagatattcgacacatgaactttgatggaacagattatggaactgtg
ctgagccagcaaatgggaaaggtttttgccctagatcatgaccctgtggaaaacaagata
tactttgcccacacagccctgaagtggatagagagagctaatatggatggttcccagcga
gaaaggcttattgaagccgtagatgtgccagaaggtcttgctgtagactggagtggccgc
agattgtactggacagacaaagggaagtctctcattgaagggagtgatttaactggaaaa
catcgtgaaataatcattaaggaaggcatctctcagccacgaggaattgctgttcatcca
gtggccaagagattattctggactgatatggggattaatccacgaattgaaagtgcttcc
cttcaaggcattggccggctggttatagctagctctgatctggtgtggcccagtggaata
acgattgattacttaactgacaagttgtattggtgtgatgccaaacggtctgtgatagaa
atggccaatctggatggttccaaacgccaaagacttgctcaaaacgatgtaggtcatcca
ttcgctgtagctgtgtttgaggatcacgtgtggttctctgattggactatgccatcggta
ataagggtgaacaagaggacaggcaaaaacagggtacgtctccgaggcagcatgctgaag
ccctcatcactggttgtagttcatcctttggcaaaaccaggagcagagccgtgcttccat
cggaatggaggctgtgaacatatttgtgaagagaggtttggaactgctcggtgttcatgt
cgtgaaggttttgtaaaagccccagatgggaaaatgtgcctggctgtgaatggccatcag
atatcagcaggtaatgaagcaggtctaaataatcaagtaacaccattggacatcttatcc
aggacaggagactttggtgataacatcacagagtctccacctatgctggtggctgaaatc
atggtgtcagatgatgacgactgtggtcctgtgggatgcagcaggcaggcgcagtgtgtt
tcagagggtgcagatgatgccacgtgtcagtgtctgaaaggatttgctggggatggaaaa
ctatgttctgatatagatgagtgtgaggtgagtgtcacagtttgccctcccacctccaag
tgcatcaatactgaaggtggctacgtttgccggtgctcagaaggctaccgaggagatggg
attcactgtctggatattgatgaatgccaactgggcacgcacacctgtgggaaaaattcc
acctgtacaaatacagtgggaaactacacctgcgtgtactctagcagcctgtctgaactg
ggacggatttgcccggactctactccaccctctcttttaggggcggatggccactattct
gtgagaaatagttacaaggaatgtcccccatctcatgacgggtactgcctcaatgatggt
gtgtgcatatacattgaggaagttgacagctatgcatgcaggtgcgccgtaggcttcgtc
ggggaccgctgccagtaccgagacctgaggtgggagctgcgccacgccggccacgggcgg
cagaggaacgtcacggtggcggccgcctgcgtggtggcactggtcctgatgctggtcctg
gggctgtgtggggcccattactacaggactcagaagatgctatcagaaaatctgaagaat
ccttatgaagagtcaagcagagaagagagcggtagcaggcctgcagacagtgaggctggg
atgtcctcttgcccccaaccttggtttgtggttttaaaggaacacgagaacctcaggaat
gggagtcaacctgtggccctcaaagatggtcaggtggcagatgttggccagctttcctcc
ctggagcctgggttagtgcaagcggtgtcctgggtgaagaagccccagatgtgcatgggc
acagagcacagacactgccttccgctgcccagtgatacaggctcctatccacaagcagtg
gggtgtagctgccgtcttccctcctgtggggcacagcccactgctgtggaagttgggaag
ccacattttcttctgtcagctaacccatcatggcaacaaaggcccctggatccaccacac
caaatggagccgactcaatga

DBGET integrated database retrieval system