KEGG   Manis javanica (Malayan pangolin): 108398270
Entry
108398270         CDS       T06054                                 

Gene name
ACVRL1
Definition
(RefSeq) serine/threonine-protein kinase receptor R3
  KO
K13594  activin receptor-like kinase 1 [EC:2.7.11.30]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108398270 (ACVRL1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mjv01001]
    108398270 (ACVRL1)
Enzymes [BR:mjv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     108398270 (ACVRL1)
Protein kinases [BR:mjv01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   108398270 (ACVRL1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase TGF_beta_GS APH Pkinase_fungal DUF4381
Other DBs
NCBI-GeneID: 108398270
NCBI-ProteinID: XP_017517612
LinkDB
Position
Unknown
AA seq 485 aa
MTLDPPKSSLLMLLMALGLTQGDPVKPSRGPLVTCTCENPHCRGPTCQGAWCTVVLVREE
GQQPQEHRGCGNLHQELCRGRPTEFVNHYCCYSPQQVDGQLPLILGPVLALLVLMALGAL
GLWHIRRRQEKQRGLHSELGDSSLILKASEQGDSMLGDLLDSDCTTGSGSGLPFLVQRTV
ARQVALVECVGKGRYGEVWRGLWHGESVAVKIFSSRDEQSWFRETEIYNTVLLRHDNILG
FIASDMTSRNSSTQLWLITHYHEHGSLYDFLQRQTLESQLALRLAVSAACGLAHLHVEIF
GTQGKPAIAHRDLKSRNVLVKSNLQCCIADLGLAVMHSQGSDYLDIGNNPRVGTKRYMAP
EVLEEQIRTDCFESYKWTDIWAFGLVLWEIARRTIVNGIVEDYRPPFYDVVPNDPSFEDM
KKVVCVDQQTPTIPNRLAADPVLSGLAQMMRECWYPNPSARLTALRIKKTLQKLSNGLQK
PKVIH
NT seq 1458 nt   +upstreamnt  +downstreamnt
atgaccttggacccccccaagagcagccttctgatgctactgatggccttgggcctgacc
cagggtgaccctgtgaagccctctcggggccccctggtgacctgcacgtgtgagaaccca
cactgcagggggcctacctgccagggggcctggtgcacagtagtgctggtgcgggaggaa
ggccaacaaccccaggagcaccgaggctgcgggaacctgcaccaggagctctgcaggggg
cgccccactgagttcgtcaaccactactgctgctacagcccccagcaagtagatggccag
ctgcctctgatcctgggccctgtgctggccttgctggtcctcatggccctgggggccctg
ggcctgtggcacatccggcggagacaggagaagcagcgtggcctgcacagcgagctggga
gactccagcctcatcctgaaggcatctgagcagggggacagcatgttaggggacctcctg
gacagcgactgcaccacaggcagtggctcggggctccctttcctggtgcagaggacagtg
gcacgccaggttgccttggtggaatgtgtgggaaagggtcgctatggtgaggtgtggagg
ggcctgtggcatggtgagagtgtggccgtcaagatcttctcctcaagggatgagcagtcc
tggttccgggagactgagatctacaacacagtgttgctcagacatgacaacatcctaggc
tttatcgcctcagacatgacttcccgcaactctagcacgcaactgtggctcatcacacac
taccatgagcatggctcgctctacgactttctgcagagacagacactggagtcccagctg
gccctgaggctggctgtgtccgcggcctgcggcctggcacatctgcacgtggagatcttc
ggcactcagggcaaacccgccattgcccaccgcgacctcaagagtcgcaatgtgctggtg
aagagcaacctgcagtgctgcatcgccgacctgggcctggccgtgatgcactcccaagga
agcgattacctggacatcggaaacaacccgcgagtgggcaccaagcggtacatggccccc
gaggtgctggaagagcagatccgcactgactgctttgaatcctacaaatggacggacatc
tgggcctttggcctggtgctgtgggagattgcccgccggaccattgtcaatggcattgtg
gaggactacaggccacccttctatgatgtggtgcccaatgatcccagctttgaggacatg
aagaaggtggtgtgtgttgaccagcagacccccaccatccccaaccggttggctgcagat
ccggtcctctcaggcctggctcagatgatgcgggagtgctggtaccccaacccctccgcc
cgcctcactgcactgcggatcaagaagacactacagaaactcagcaatggtctccagaag
cctaaagtgattcactag

DBGET integrated database retrieval system