KEGG   Manis javanica (Malayan pangolin): 108398274
Entry
108398274         CDS       T06054                                 

Gene name
ACVR1B
Definition
(RefSeq) activin receptor type-1B isoform X1
  KO
K13567  activin receptor type-1B [EC:2.7.11.30]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04350  TGF-beta signaling pathway
mjv04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    108398274 (ACVR1B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108398274 (ACVR1B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    108398274 (ACVR1B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mjv01001]
    108398274 (ACVR1B)
Enzymes [BR:mjv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     108398274 (ACVR1B)
Protein kinases [BR:mjv01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   108398274 (ACVR1B)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr TGF_beta_GS APH Pkinase_fungal Activin_recp FTA2
Other DBs
NCBI-GeneID: 108398274
NCBI-ProteinID: XP_017517626
LinkDB
Position
Unknown
AA seq 452 aa
MVSIFNLDGMEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYTDFCNKIDLRVPSGH
LKEPEHPSMWGPVELVGIIAGPVFLLFLIIIVFLVINYHQRVYHNRQRLDMEDPSCEMCL
SKDKTLQDLVYDLSTSGSGSGLPLFVQRTVARTIVLQEIIGKGRFGEVWRGRWRGGDVAV
KIFSSREERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDY
LNRYTVTIEGMIKLALSAASGLAHLHMEIVGTQGKPGIAHRDLKSKNILVKKNGMCAIAD
LGLAVRHDAVTDTIDIAPNQRVGTKRYMAPEVLDESINMKHFDSFKCADIYALGLVYWEI
ARRCNSGGVHEEYQLPYYDLVPSDPSIEEMRKVVCDQKLRPNIPNWWQSYEALRVMGKMM
RECWYANGAARLTALRIKKTLSQLSVQEDVKI
NT seq 1359 nt   +upstreamnt  +downstreamnt
atggtttccattttcaacctggatgggatggagcaccacgtgcgcacatgcatccctaaa
gtggagctggtccctgccgggaagcccttctactgcctgagctccgaggatctgcgcaac
acccactgctgctatactgacttctgcaacaagatcgacctgagggtgcccagtggtcac
ctcaaggagcctgagcacccttccatgtggggccctgtggagctggtaggcattattgct
ggcccagtgttcctcctgtttctcataatcatcgttttccttgtcattaactatcatcag
cgtgtctatcacaaccgccagagactggacatggaagatccctcgtgtgagatgtgtctc
tccaaagacaagacgctccaggatctggtgtacgatctctctacatcagggtctggctca
gggttgcccctttttgtccagcgcacagtggcccgaaccatcgttttacaggagatcatt
ggcaagggccggtttggggaggtgtggcgtggccgctggaggggtggtgatgtagctgtg
aaaattttctcctcccgtgaagaacggtcctggttccgggaagcagagatctaccagact
gtcatgttgcggcacgaaaacatccttgggtttattgctgctgacaataaagataatggc
acctggacgcagctgtggcttgtctcagactaccatgagcacggctccctgtttgattat
cttaaccggtacacagtgacaatcgaggggatgattaagctggccttgtctgctgctagt
gggctagcacacctgcacatggagatcgtgggtacccaagggaagcctggaattgctcat
cgagacttaaagtcaaagaacatcctagtgaagaaaaatggcatgtgtgccattgcagac
ctgggcctggctgtccgtcatgatgccgtcactgacaccattgacattgccccaaatcag
agggtggggaccaaacgctacatggcccctgaagtacttgatgaaagcataaacatgaag
cactttgactcctttaaatgtgctgatatctacgccctggggcttgtatattgggagatt
gcccggaggtgcaattctggaggagtccatgaagagtatcagctgccatattatgactta
gtgccgtctgacccttccattgaggaaatgcgaaaggtcgtgtgtgaccagaagctgcgt
cccaacatccccaactggtggcagagttatgaggccttacgggtgatggggaagatgatg
cgagagtgttggtatgccaacggcgcggcccgcttgaccgctctgcgcattaagaagacc
ctctcacagctcagcgtgcaggaagatgtgaagatctaa

DBGET integrated database retrieval system