Manis javanica (Malayan pangolin): 108398454 Help Entry 108398454         CDS       T06054                                  Gene name MAPK3 Definition (RefSeq) mitogen-activated protein kinase 3   KO K04371   mitogen-activated protein kinase 1/3 [EC:2.7.11.24] Organism mjv  Manis javanica (Malayan pangolin) Pathway mjv01521   EGFR tyrosine kinase inhibitor resistance mjv01522   Endocrine resistance mjv01524   Platinum drug resistance mjv04010   MAPK signaling pathway mjv04012   ErbB signaling pathway mjv04014   Ras signaling pathway mjv04015   Rap1 signaling pathway mjv04022   cGMP-PKG signaling pathway mjv04024   cAMP signaling pathway mjv04062   Chemokine signaling pathway mjv04066   HIF-1 signaling pathway mjv04068   FoxO signaling pathway mjv04071   Sphingolipid signaling pathway mjv04072   Phospholipase D signaling pathway mjv04114   Oocyte meiosis mjv04140   Autophagy - animal mjv04150   mTOR signaling pathway mjv04151   PI3K-Akt signaling pathway mjv04210   Apoptosis mjv04218   Cellular senescence mjv04261   Adrenergic signaling in cardiomyocytes mjv04270   Vascular smooth muscle contraction mjv04350   TGF-beta signaling pathway mjv04360   Axon guidance mjv04370   VEGF signaling pathway mjv04371   Apelin signaling pathway mjv04380   Osteoclast differentiation mjv04510   Focal adhesion mjv04520   Adherens junction mjv04540   Gap junction mjv04550   Signaling pathways regulating pluripotency of stem cells mjv04611   Platelet activation mjv04613   Neutrophil extracellular trap formation mjv04620   Toll-like receptor signaling pathway mjv04621   NOD-like receptor signaling pathway mjv04625   C-type lectin receptor signaling pathway mjv04650   Natural killer cell mediated cytotoxicity mjv04657   IL-17 signaling pathway mjv04658   Th1 and Th2 cell differentiation mjv04659   Th17 cell differentiation mjv04660   T cell receptor signaling pathway mjv04662   B cell receptor signaling pathway mjv04664   Fc epsilon RI signaling pathway mjv04666   Fc gamma R-mediated phagocytosis mjv04668   TNF signaling pathway mjv04713   Circadian entrainment mjv04720   Long-term potentiation mjv04722   Neurotrophin signaling pathway mjv04723   Retrograde endocannabinoid signaling mjv04724   Glutamatergic synapse mjv04725   Cholinergic synapse mjv04726   Serotonergic synapse mjv04730   Long-term depression mjv04810   Regulation of actin cytoskeleton mjv04910   Insulin signaling pathway mjv04912   GnRH signaling pathway mjv04914   Progesterone-mediated oocyte maturation mjv04915   Estrogen signaling pathway mjv04916   Melanogenesis mjv04917   Prolactin signaling pathway mjv04919   Thyroid hormone signaling pathway mjv04921   Oxytocin signaling pathway mjv04926   Relaxin signaling pathway mjv04928   Parathyroid hormone synthesis, secretion and action mjv04929   GnRH secretion mjv04930   Type II diabetes mellitus mjv04933   AGE-RAGE signaling pathway in diabetic complications mjv04934   Cushing syndrome mjv04935   Growth hormone synthesis, secretion and action mjv04960   Aldosterone-regulated sodium reabsorption mjv05010   Alzheimer disease mjv05020   Prion disease mjv05022   Pathways of neurodegeneration - multiple diseases mjv05034   Alcoholism mjv05132   Salmonella infection mjv05133   Pertussis mjv05135   Yersinia infection mjv05140   Leishmaniasis mjv05142   Chagas disease mjv05145   Toxoplasmosis mjv05152   Tuberculosis mjv05160   Hepatitis C mjv05161   Hepatitis B mjv05163   Human cytomegalovirus infection mjv05164   Influenza A mjv05165   Human papillomavirus infection mjv05166   Human T-cell leukemia virus 1 infection mjv05167   Kaposi sarcoma-associated herpesvirus infection mjv05170   Human immunodeficiency virus 1 infection mjv05171   Coronavirus disease - COVID-19 mjv05200   Pathways in cancer mjv05203   Viral carcinogenesis mjv05205   Proteoglycans in cancer mjv05206   MicroRNAs in cancer mjv05210   Colorectal cancer mjv05211   Renal cell carcinoma mjv05212   Pancreatic cancer mjv05213   Endometrial cancer mjv05214   Glioma mjv05215   Prostate cancer mjv05216   Thyroid cancer mjv05218   Melanoma mjv05219   Bladder cancer mjv05220   Chronic myeloid leukemia mjv05221   Acute myeloid leukemia mjv05223   Non-small cell lung cancer mjv05224   Breast cancer mjv05225   Hepatocellular carcinoma mjv05226   Gastric cancer mjv05230   Central carbon metabolism in cancer mjv05231   Choline metabolism in cancer mjv05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:mjv00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     108398454 (MAPK3)    04012 ErbB signaling pathway     108398454 (MAPK3)    04014 Ras signaling pathway     108398454 (MAPK3)    04015 Rap1 signaling pathway     108398454 (MAPK3)    04350 TGF-beta signaling pathway     108398454 (MAPK3)    04370 VEGF signaling pathway     108398454 (MAPK3)    04371 Apelin signaling pathway     108398454 (MAPK3)    04668 TNF signaling pathway     108398454 (MAPK3)    04066 HIF-1 signaling pathway     108398454 (MAPK3)    04068 FoxO signaling pathway     108398454 (MAPK3)    04072 Phospholipase D signaling pathway     108398454 (MAPK3)    04071 Sphingolipid signaling pathway     108398454 (MAPK3)    04024 cAMP signaling pathway     108398454 (MAPK3)    04022 cGMP-PKG signaling pathway     108398454 (MAPK3)    04151 PI3K-Akt signaling pathway     108398454 (MAPK3)    04150 mTOR signaling pathway     108398454 (MAPK3)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     108398454 (MAPK3)   09143 Cell growth and death    04114 Oocyte meiosis     108398454 (MAPK3)    04210 Apoptosis     108398454 (MAPK3)    04218 Cellular senescence     108398454 (MAPK3)   09144 Cellular community - eukaryotes    04510 Focal adhesion     108398454 (MAPK3)    04520 Adherens junction     108398454 (MAPK3)    04540 Gap junction     108398454 (MAPK3)    04550 Signaling pathways regulating pluripotency of stem cells     108398454 (MAPK3)   09142 Cell motility    04810 Regulation of actin cytoskeleton     108398454 (MAPK3)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     108398454 (MAPK3)    04613 Neutrophil extracellular trap formation     108398454 (MAPK3)    04620 Toll-like receptor signaling pathway     108398454 (MAPK3)    04621 NOD-like receptor signaling pathway     108398454 (MAPK3)    04625 C-type lectin receptor signaling pathway     108398454 (MAPK3)    04650 Natural killer cell mediated cytotoxicity     108398454 (MAPK3)    04660 T cell receptor signaling pathway     108398454 (MAPK3)    04658 Th1 and Th2 cell differentiation     108398454 (MAPK3)    04659 Th17 cell differentiation     108398454 (MAPK3)    04657 IL-17 signaling pathway     108398454 (MAPK3)    04662 B cell receptor signaling pathway     108398454 (MAPK3)    04664 Fc epsilon RI signaling pathway     108398454 (MAPK3)    04666 Fc gamma R-mediated phagocytosis     108398454 (MAPK3)    04062 Chemokine signaling pathway     108398454 (MAPK3)   09152 Endocrine system    04910 Insulin signaling pathway     108398454 (MAPK3)    04929 GnRH secretion     108398454 (MAPK3)    04912 GnRH signaling pathway     108398454 (MAPK3)    04915 Estrogen signaling pathway     108398454 (MAPK3)    04914 Progesterone-mediated oocyte maturation     108398454 (MAPK3)    04917 Prolactin signaling pathway     108398454 (MAPK3)    04921 Oxytocin signaling pathway     108398454 (MAPK3)    04926 Relaxin signaling pathway     108398454 (MAPK3)    04935 Growth hormone synthesis, secretion and action     108398454 (MAPK3)    04919 Thyroid hormone signaling pathway     108398454 (MAPK3)    04928 Parathyroid hormone synthesis, secretion and action     108398454 (MAPK3)    04916 Melanogenesis     108398454 (MAPK3)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     108398454 (MAPK3)    04270 Vascular smooth muscle contraction     108398454 (MAPK3)   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     108398454 (MAPK3)   09156 Nervous system    04724 Glutamatergic synapse     108398454 (MAPK3)    04725 Cholinergic synapse     108398454 (MAPK3)    04726 Serotonergic synapse     108398454 (MAPK3)    04720 Long-term potentiation     108398454 (MAPK3)    04730 Long-term depression     108398454 (MAPK3)    04723 Retrograde endocannabinoid signaling     108398454 (MAPK3)    04722 Neurotrophin signaling pathway     108398454 (MAPK3)   09158 Development and regeneration    04360 Axon guidance     108398454 (MAPK3)    04380 Osteoclast differentiation     108398454 (MAPK3)   09159 Environmental adaptation    04713 Circadian entrainment     108398454 (MAPK3)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     108398454 (MAPK3)    05206 MicroRNAs in cancer     108398454 (MAPK3)    05205 Proteoglycans in cancer     108398454 (MAPK3)    05203 Viral carcinogenesis     108398454 (MAPK3)    05230 Central carbon metabolism in cancer     108398454 (MAPK3)    05231 Choline metabolism in cancer     108398454 (MAPK3)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     108398454 (MAPK3)   09162 Cancer: specific types    05210 Colorectal cancer     108398454 (MAPK3)    05212 Pancreatic cancer     108398454 (MAPK3)    05225 Hepatocellular carcinoma     108398454 (MAPK3)    05226 Gastric cancer     108398454 (MAPK3)    05214 Glioma     108398454 (MAPK3)    05216 Thyroid cancer     108398454 (MAPK3)    05221 Acute myeloid leukemia     108398454 (MAPK3)    05220 Chronic myeloid leukemia     108398454 (MAPK3)    05218 Melanoma     108398454 (MAPK3)    05211 Renal cell carcinoma     108398454 (MAPK3)    05219 Bladder cancer     108398454 (MAPK3)    05215 Prostate cancer     108398454 (MAPK3)    05213 Endometrial cancer     108398454 (MAPK3)    05224 Breast cancer     108398454 (MAPK3)    05223 Non-small cell lung cancer     108398454 (MAPK3)   09164 Neurodegenerative disease    05010 Alzheimer disease     108398454 (MAPK3)    05020 Prion disease     108398454 (MAPK3)    05022 Pathways of neurodegeneration - multiple diseases     108398454 (MAPK3)   09165 Substance dependence    05034 Alcoholism     108398454 (MAPK3)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     108398454 (MAPK3)    04933 AGE-RAGE signaling pathway in diabetic complications     108398454 (MAPK3)    04934 Cushing syndrome     108398454 (MAPK3)   09171 Infectious disease: bacterial    05132 Salmonella infection     108398454 (MAPK3)    05135 Yersinia infection     108398454 (MAPK3)    05133 Pertussis     108398454 (MAPK3)    05152 Tuberculosis     108398454 (MAPK3)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     108398454 (MAPK3)    05170 Human immunodeficiency virus 1 infection     108398454 (MAPK3)    05161 Hepatitis B     108398454 (MAPK3)    05160 Hepatitis C     108398454 (MAPK3)    05171 Coronavirus disease - COVID-19     108398454 (MAPK3)    05164 Influenza A     108398454 (MAPK3)    05163 Human cytomegalovirus infection     108398454 (MAPK3)    05167 Kaposi sarcoma-associated herpesvirus infection     108398454 (MAPK3)    05165 Human papillomavirus infection     108398454 (MAPK3)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     108398454 (MAPK3)    05140 Leishmaniasis     108398454 (MAPK3)    05142 Chagas disease     108398454 (MAPK3)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     108398454 (MAPK3)    01524 Platinum drug resistance     108398454 (MAPK3)    01522 Endocrine resistance     108398454 (MAPK3)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:mjv01001]     108398454 (MAPK3)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mjv03036]     108398454 (MAPK3)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mjv04147]     108398454 (MAPK3) Enzymes [BR:mjv01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      108398454 (MAPK3) Protein kinases [BR:mjv01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    108398454 (MAPK3) Chromosome and associated proteins [BR:mjv03036]  Eukaryotic type   Centromeric chromatin formation proteins    SAC (spindle assembly checkpoint) factors     Protein kinases      108398454 (MAPK3) Exosome [BR:mjv04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    108398454 (MAPK3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr APH Kdo FTA2 Choline_kinase Motif Other DBs NCBI-GeneID:  108398454 NCBI-ProteinID:  XP_017517988 LinkDB All DBs Position Unknown AA seq 354 aa AA seqDB search GGVETVKGQPFDVGPRYTQLQYIGEGAYGMVSSAYDHACKIRVAIKKISPFEHQTYCQRT LREIQILLRFRHENVIGIRDILRAPTLEVMRDVYIVQDLMETDLYKLLKSQQLSNDHVCY FLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLARIADPEHDHTGFLTEYV ATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPS QEDLNCIINLKARNYLQSLPSKTKVAWTKLFPKSDSKALDLLDRMLTFNPNKRITVEEAL AHPYLEQYYDPTDEPVAEEPFTFDMELDDLPKERLKELIFQETARFQPGAPEAP NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt gggggagtggagacagtgaagggacagccgttcgacgtgggcccgcgctacacgcagctc cagtacatcggcgagggcgcttacggcatggtcagctcagcttatgaccatgcgtgcaag attcgcgtggccatcaagaaaatcagcccctttgagcatcagacctactgccagcgcaca ctgcgggagatccagatcttgctgcgcttccgccatgagaacgttattggcattcgagac attctgcgggcacccaccctggaagtcatgagggatgtctatattgtgcaggacctgatg gagacagacctgtacaagttgctcaaaagccagcagctgagcaacgaccacgtttgctac ttcctctaccagatccttcggggcctcaagtatatccactcagccaatgtgctccaccga gatttaaagccctccaacttgctcatcaacaccacctgcgaccttaagatctgtgatttt ggcctggcccgaattgctgatcctgaacatgaccacactggcttcctgactgagtatgtg gccacacgctggtaccgtgccccagagatcatgcttaactccaagggctataccaagtcc attgacatctggtctgtgggctgcattctggctgagatgctctccaaccggcccatcttc cctggcaagcactacctggaccagctcaaccacattctgggtatcctgggctccccatcc caggaggacctgaattgtatcatcaacctgaaggcccgaaactacttacagtctctgcct tccaagaccaaggtggcctggaccaagctgtttcccaagtcagactccaaagcacttgac ctgctggaccggatgttgacctttaaccccaacaaacggatcacagtggaggaagctctg gctcacccctacctggagcaatactacgacccaacggatgagccagtggctgaggaacct ttcaccttcgacatggagctggatgatctacccaaggagcggctgaaggagctcatcttc caggagacagcccgcttccagcctggggcaccggaggccccctaa

Manis javanica (Malayan pangolin): 108400663 Help Entry 108400663         CDS       T06054                                  Gene name MAPK1 Definition (RefSeq) mitogen-activated protein kinase 1   KO K04371   mitogen-activated protein kinase 1/3 [EC:2.7.11.24] Organism mjv  Manis javanica (Malayan pangolin) Pathway mjv01521   EGFR tyrosine kinase inhibitor resistance mjv01522   Endocrine resistance mjv01524   Platinum drug resistance mjv04010   MAPK signaling pathway mjv04012   ErbB signaling pathway mjv04014   Ras signaling pathway mjv04015   Rap1 signaling pathway mjv04022   cGMP-PKG signaling pathway mjv04024   cAMP signaling pathway mjv04062   Chemokine signaling pathway mjv04066   HIF-1 signaling pathway mjv04068   FoxO signaling pathway mjv04071   Sphingolipid signaling pathway mjv04072   Phospholipase D signaling pathway mjv04114   Oocyte meiosis mjv04140   Autophagy - animal mjv04150   mTOR signaling pathway mjv04151   PI3K-Akt signaling pathway mjv04210   Apoptosis mjv04218   Cellular senescence mjv04261   Adrenergic signaling in cardiomyocytes mjv04270   Vascular smooth muscle contraction mjv04350   TGF-beta signaling pathway mjv04360   Axon guidance mjv04370   VEGF signaling pathway mjv04371   Apelin signaling pathway mjv04380   Osteoclast differentiation mjv04510   Focal adhesion mjv04520   Adherens junction mjv04540   Gap junction mjv04550   Signaling pathways regulating pluripotency of stem cells mjv04611   Platelet activation mjv04613   Neutrophil extracellular trap formation mjv04620   Toll-like receptor signaling pathway mjv04621   NOD-like receptor signaling pathway mjv04625   C-type lectin receptor signaling pathway mjv04650   Natural killer cell mediated cytotoxicity mjv04657   IL-17 signaling pathway mjv04658   Th1 and Th2 cell differentiation mjv04659   Th17 cell differentiation mjv04660   T cell receptor signaling pathway mjv04662   B cell receptor signaling pathway mjv04664   Fc epsilon RI signaling pathway mjv04666   Fc gamma R-mediated phagocytosis mjv04668   TNF signaling pathway mjv04713   Circadian entrainment mjv04720   Long-term potentiation mjv04722   Neurotrophin signaling pathway mjv04723   Retrograde endocannabinoid signaling mjv04724   Glutamatergic synapse mjv04725   Cholinergic synapse mjv04726   Serotonergic synapse mjv04730   Long-term depression mjv04810   Regulation of actin cytoskeleton mjv04910   Insulin signaling pathway mjv04912   GnRH signaling pathway mjv04914   Progesterone-mediated oocyte maturation mjv04915   Estrogen signaling pathway mjv04916   Melanogenesis mjv04917   Prolactin signaling pathway mjv04919   Thyroid hormone signaling pathway mjv04921   Oxytocin signaling pathway mjv04926   Relaxin signaling pathway mjv04928   Parathyroid hormone synthesis, secretion and action mjv04929   GnRH secretion mjv04930   Type II diabetes mellitus mjv04933   AGE-RAGE signaling pathway in diabetic complications mjv04934   Cushing syndrome mjv04935   Growth hormone synthesis, secretion and action mjv04960   Aldosterone-regulated sodium reabsorption mjv05010   Alzheimer disease mjv05020   Prion disease mjv05022   Pathways of neurodegeneration - multiple diseases mjv05034   Alcoholism mjv05132   Salmonella infection mjv05133   Pertussis mjv05135   Yersinia infection mjv05140   Leishmaniasis mjv05142   Chagas disease mjv05145   Toxoplasmosis mjv05152   Tuberculosis mjv05160   Hepatitis C mjv05161   Hepatitis B mjv05163   Human cytomegalovirus infection mjv05164   Influenza A mjv05165   Human papillomavirus infection mjv05166   Human T-cell leukemia virus 1 infection mjv05167   Kaposi sarcoma-associated herpesvirus infection mjv05170   Human immunodeficiency virus 1 infection mjv05171   Coronavirus disease - COVID-19 mjv05200   Pathways in cancer mjv05203   Viral carcinogenesis mjv05205   Proteoglycans in cancer mjv05206   MicroRNAs in cancer mjv05210   Colorectal cancer mjv05211   Renal cell carcinoma mjv05212   Pancreatic cancer mjv05213   Endometrial cancer mjv05214   Glioma mjv05215   Prostate cancer mjv05216   Thyroid cancer mjv05218   Melanoma mjv05219   Bladder cancer mjv05220   Chronic myeloid leukemia mjv05221   Acute myeloid leukemia mjv05223   Non-small cell lung cancer mjv05224   Breast cancer mjv05225   Hepatocellular carcinoma mjv05226   Gastric cancer mjv05230   Central carbon metabolism in cancer mjv05231   Choline metabolism in cancer mjv05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:mjv00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     108400663 (MAPK1)    04012 ErbB signaling pathway     108400663 (MAPK1)    04014 Ras signaling pathway     108400663 (MAPK1)    04015 Rap1 signaling pathway     108400663 (MAPK1)    04350 TGF-beta signaling pathway     108400663 (MAPK1)    04370 VEGF signaling pathway     108400663 (MAPK1)    04371 Apelin signaling pathway     108400663 (MAPK1)    04668 TNF signaling pathway     108400663 (MAPK1)    04066 HIF-1 signaling pathway     108400663 (MAPK1)    04068 FoxO signaling pathway     108400663 (MAPK1)    04072 Phospholipase D signaling pathway     108400663 (MAPK1)    04071 Sphingolipid signaling pathway     108400663 (MAPK1)    04024 cAMP signaling pathway     108400663 (MAPK1)    04022 cGMP-PKG signaling pathway     108400663 (MAPK1)    04151 PI3K-Akt signaling pathway     108400663 (MAPK1)    04150 mTOR signaling pathway     108400663 (MAPK1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     108400663 (MAPK1)   09143 Cell growth and death    04114 Oocyte meiosis     108400663 (MAPK1)    04210 Apoptosis     108400663 (MAPK1)    04218 Cellular senescence     108400663 (MAPK1)   09144 Cellular community - eukaryotes    04510 Focal adhesion     108400663 (MAPK1)    04520 Adherens junction     108400663 (MAPK1)    04540 Gap junction     108400663 (MAPK1)    04550 Signaling pathways regulating pluripotency of stem cells     108400663 (MAPK1)   09142 Cell motility    04810 Regulation of actin cytoskeleton     108400663 (MAPK1)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     108400663 (MAPK1)    04613 Neutrophil extracellular trap formation     108400663 (MAPK1)    04620 Toll-like receptor signaling pathway     108400663 (MAPK1)    04621 NOD-like receptor signaling pathway     108400663 (MAPK1)    04625 C-type lectin receptor signaling pathway     108400663 (MAPK1)    04650 Natural killer cell mediated cytotoxicity     108400663 (MAPK1)    04660 T cell receptor signaling pathway     108400663 (MAPK1)    04658 Th1 and Th2 cell differentiation     108400663 (MAPK1)    04659 Th17 cell differentiation     108400663 (MAPK1)    04657 IL-17 signaling pathway     108400663 (MAPK1)    04662 B cell receptor signaling pathway     108400663 (MAPK1)    04664 Fc epsilon RI signaling pathway     108400663 (MAPK1)    04666 Fc gamma R-mediated phagocytosis     108400663 (MAPK1)    04062 Chemokine signaling pathway     108400663 (MAPK1)   09152 Endocrine system    04910 Insulin signaling pathway     108400663 (MAPK1)    04929 GnRH secretion     108400663 (MAPK1)    04912 GnRH signaling pathway     108400663 (MAPK1)    04915 Estrogen signaling pathway     108400663 (MAPK1)    04914 Progesterone-mediated oocyte maturation     108400663 (MAPK1)    04917 Prolactin signaling pathway     108400663 (MAPK1)    04921 Oxytocin signaling pathway     108400663 (MAPK1)    04926 Relaxin signaling pathway     108400663 (MAPK1)    04935 Growth hormone synthesis, secretion and action     108400663 (MAPK1)    04919 Thyroid hormone signaling pathway     108400663 (MAPK1)    04928 Parathyroid hormone synthesis, secretion and action     108400663 (MAPK1)    04916 Melanogenesis     108400663 (MAPK1)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     108400663 (MAPK1)    04270 Vascular smooth muscle contraction     108400663 (MAPK1)   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     108400663 (MAPK1)   09156 Nervous system    04724 Glutamatergic synapse     108400663 (MAPK1)    04725 Cholinergic synapse     108400663 (MAPK1)    04726 Serotonergic synapse     108400663 (MAPK1)    04720 Long-term potentiation     108400663 (MAPK1)    04730 Long-term depression     108400663 (MAPK1)    04723 Retrograde endocannabinoid signaling     108400663 (MAPK1)    04722 Neurotrophin signaling pathway     108400663 (MAPK1)   09158 Development and regeneration    04360 Axon guidance     108400663 (MAPK1)    04380 Osteoclast differentiation     108400663 (MAPK1)   09159 Environmental adaptation    04713 Circadian entrainment     108400663 (MAPK1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     108400663 (MAPK1)    05206 MicroRNAs in cancer     108400663 (MAPK1)    05205 Proteoglycans in cancer     108400663 (MAPK1)    05203 Viral carcinogenesis     108400663 (MAPK1)    05230 Central carbon metabolism in cancer     108400663 (MAPK1)    05231 Choline metabolism in cancer     108400663 (MAPK1)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     108400663 (MAPK1)   09162 Cancer: specific types    05210 Colorectal cancer     108400663 (MAPK1)    05212 Pancreatic cancer     108400663 (MAPK1)    05225 Hepatocellular carcinoma     108400663 (MAPK1)    05226 Gastric cancer     108400663 (MAPK1)    05214 Glioma     108400663 (MAPK1)    05216 Thyroid cancer     108400663 (MAPK1)    05221 Acute myeloid leukemia     108400663 (MAPK1)    05220 Chronic myeloid leukemia     108400663 (MAPK1)    05218 Melanoma     108400663 (MAPK1)    05211 Renal cell carcinoma     108400663 (MAPK1)    05219 Bladder cancer     108400663 (MAPK1)    05215 Prostate cancer     108400663 (MAPK1)    05213 Endometrial cancer     108400663 (MAPK1)    05224 Breast cancer     108400663 (MAPK1)    05223 Non-small cell lung cancer     108400663 (MAPK1)   09164 Neurodegenerative disease    05010 Alzheimer disease     108400663 (MAPK1)    05020 Prion disease     108400663 (MAPK1)    05022 Pathways of neurodegeneration - multiple diseases     108400663 (MAPK1)   09165 Substance dependence    05034 Alcoholism     108400663 (MAPK1)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     108400663 (MAPK1)    04933 AGE-RAGE signaling pathway in diabetic complications     108400663 (MAPK1)    04934 Cushing syndrome     108400663 (MAPK1)   09171 Infectious disease: bacterial    05132 Salmonella infection     108400663 (MAPK1)    05135 Yersinia infection     108400663 (MAPK1)    05133 Pertussis     108400663 (MAPK1)    05152 Tuberculosis     108400663 (MAPK1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     108400663 (MAPK1)    05170 Human immunodeficiency virus 1 infection     108400663 (MAPK1)    05161 Hepatitis B     108400663 (MAPK1)    05160 Hepatitis C     108400663 (MAPK1)    05171 Coronavirus disease - COVID-19     108400663 (MAPK1)    05164 Influenza A     108400663 (MAPK1)    05163 Human cytomegalovirus infection     108400663 (MAPK1)    05167 Kaposi sarcoma-associated herpesvirus infection     108400663 (MAPK1)    05165 Human papillomavirus infection     108400663 (MAPK1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     108400663 (MAPK1)    05140 Leishmaniasis     108400663 (MAPK1)    05142 Chagas disease     108400663 (MAPK1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     108400663 (MAPK1)    01524 Platinum drug resistance     108400663 (MAPK1)    01522 Endocrine resistance     108400663 (MAPK1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:mjv01001]     108400663 (MAPK1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mjv03036]     108400663 (MAPK1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mjv04147]     108400663 (MAPK1) Enzymes [BR:mjv01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      108400663 (MAPK1) Protein kinases [BR:mjv01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    108400663 (MAPK1) Chromosome and associated proteins [BR:mjv03036]  Eukaryotic type   Centromeric chromatin formation proteins    SAC (spindle assembly checkpoint) factors     Protein kinases      108400663 (MAPK1) Exosome [BR:mjv04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    108400663 (MAPK1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr APH FTA2 Choline_kinase Kdo Kinase-like Motif Other DBs NCBI-GeneID:  108400663 NCBI-ProteinID:  XP_017521675 LinkDB All DBs Position Unknown AA seq 333 aa AA seqDB search MPSLLCPFLNFFSSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGIN DIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLH RDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTK SIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSL PHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEA PFKFDMELDDLPKEKLKELIFEETARFQPGYRS NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt atgccttctctcctctgcccctttttaaatttttttagttctgcatatgataacgtcaac aaagttcgagtagctatcaagaaaatcagtccttttgaacaccagacctactgccagaga accctgagggagataaaaatcttactgcgtttcagacatgagaacatcattggaattaac gatattattcgagcaccaaccattgagcaaatgaaagatgtctatatagtacaggacctc atggaaacagatctctacaagctcttgaagacgcagcacctcagcaatgaccacatctgc tattttctttaccagatcctcagagggttaaaatatatccattcagctaacgtactacac cgtgacctcaaaccttctaacctgctgctcaacaccacctgcgatctcaagatctgtgac tttggcttggcccgtgttgccgatccggaccatgatcatacagggttcctgacagagtac gtagccacacgttggtacagggctccagaaattatgttgaattccaagggctataccaag tccattgatatttggtccgtaggctgcattctggcagagatgctctccaataggcccatc ttcccggggaagcattatcttgaccagctgaaccacattctgggtatacttggatcccca tcacaggaagacctgaactgtataataaatttaaaagctagaaactatttgctttctctt ccacacaaaaataaggtgccatggaacaggctgttcccaaatgctgactccaaagctctg gatttactggacaaaatgttgacattcaaccctcacaagaggattgaggtagaacaggct ctggcccacccatatctggagcagtattatgacccaagtgatgagcccatcgctgaagca ccattcaagttcgacatggaattggatgacttgcccaaggaaaagctcaaagaactcata tttgaagagactgctagattccagccaggatacagatcttaa

DBGET integrated database retrieval system