KEGG   Manis javanica (Malayan pangolin): 108398862
Entry
108398862         CDS       T06054                                 

Gene name
BBC3
Definition
(RefSeq) bcl-2-binding component 3
  KO
K10132  Bcl-2-binding component 3
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01524  Platinum drug resistance
mjv04115  p53 signaling pathway
mjv04210  Apoptosis
mjv04215  Apoptosis - multiple species
mjv04390  Hippo signaling pathway
mjv05016  Huntington disease
mjv05162  Measles
mjv05200  Pathways in cancer
mjv05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    108398862 (BBC3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108398862 (BBC3)
   04215 Apoptosis - multiple species
    108398862 (BBC3)
   04115 p53 signaling pathway
    108398862 (BBC3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108398862 (BBC3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108398862 (BBC3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    108398862 (BBC3)
  09172 Infectious disease: viral
   05162 Measles
    108398862 (BBC3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108398862 (BBC3)
SSDB
Motif
Pfam: PUMA Hepatitis_core
Other DBs
NCBI-GeneID: 108398862
NCBI-ProteinID: XP_017518688
LinkDB
Position
Unknown
AA seq 204 aa
MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAXRDDGICGARLAPSRPAQSVAGEKVL
LPKPSPPPPGPCGPGVNGKANFPGPGLWQCVRRGPNFKTRVTGPQPSLSPGEQHLESPVP
SAPGALAGGPTQAAPGIRGEEEQWAREIGAQLRRMADDLNALYERRRQEEQQRHRPSPWR
VLYNLIMGLLPLPRGRGTPEMEPN
NT seq 615 nt   +upstreamnt  +downstreamnt
atggcccgagcacgccaggagggcagctccccggagcccgtagagggcctggcccgcgac
ggcccgcgccctttccccctcagccgcctggtgccctccgccnccagggacgacgggatc
tgcggtgcccggctagccccatcccggccggcgcagtcggtggcaggggagaaggtcctg
ctgcccaagccttccccacccccacccgggccctgcggcccaggcgttaacgggaaagca
aacttccccggccccggtctctggcagtgcgtcaggaggggaccaaatttcaagaccaga
gttacaggtcctcagccctcgctctcgcccggggagcagcacctggaatcgcctgtgccc
agcgccccgggggccctggcgggaggccccacccaagcggccccgggaatccggggggag
gaggagcagtgggcccgagagatcggggcccagctgcggcggatggcggacgacctcaac
gcgctgtacgaacggcggagacaagaggagcagcagcgacaccgcccctcaccctggagg
gtcctgtacaatctcatcatgggactcctgcccttgcccaggggccgtggaacccccgag
atggagcccaattag

DBGET integrated database retrieval system