KEGG   Manis javanica (Malayan pangolin): 108398898
Entry
108398898         CDS       T06054                                 

Gene name
CASP8
Definition
(RefSeq) caspase-8
  KO
K04398  caspase 8 [EC:3.4.22.61]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01524  Platinum drug resistance
mjv04115  p53 signaling pathway
mjv04210  Apoptosis
mjv04215  Apoptosis - multiple species
mjv04217  Necroptosis
mjv04620  Toll-like receptor signaling pathway
mjv04621  NOD-like receptor signaling pathway
mjv04622  RIG-I-like receptor signaling pathway
mjv04625  C-type lectin receptor signaling pathway
mjv04657  IL-17 signaling pathway
mjv04668  TNF signaling pathway
mjv04932  Non-alcoholic fatty liver disease
mjv05010  Alzheimer disease
mjv05016  Huntington disease
mjv05022  Pathways of neurodegeneration - multiple diseases
mjv05132  Salmonella infection
mjv05134  Legionellosis
mjv05142  Chagas disease
mjv05145  Toxoplasmosis
mjv05152  Tuberculosis
mjv05160  Hepatitis C
mjv05161  Hepatitis B
mjv05162  Measles
mjv05163  Human cytomegalovirus infection
mjv05164  Influenza A
mjv05165  Human papillomavirus infection
mjv05167  Kaposi sarcoma-associated herpesvirus infection
mjv05168  Herpes simplex virus 1 infection
mjv05169  Epstein-Barr virus infection
mjv05170  Human immunodeficiency virus 1 infection
mjv05200  Pathways in cancer
mjv05203  Viral carcinogenesis
mjv05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    108398898 (CASP8)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108398898 (CASP8)
   04215 Apoptosis - multiple species
    108398898 (CASP8)
   04217 Necroptosis
    108398898 (CASP8)
   04115 p53 signaling pathway
    108398898 (CASP8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108398898 (CASP8)
   04621 NOD-like receptor signaling pathway
    108398898 (CASP8)
   04622 RIG-I-like receptor signaling pathway
    108398898 (CASP8)
   04625 C-type lectin receptor signaling pathway
    108398898 (CASP8)
   04657 IL-17 signaling pathway
    108398898 (CASP8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108398898 (CASP8)
   05203 Viral carcinogenesis
    108398898 (CASP8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108398898 (CASP8)
   05016 Huntington disease
    108398898 (CASP8)
   05022 Pathways of neurodegeneration - multiple diseases
    108398898 (CASP8)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    108398898 (CASP8)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    108398898 (CASP8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108398898 (CASP8)
   05134 Legionellosis
    108398898 (CASP8)
   05152 Tuberculosis
    108398898 (CASP8)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108398898 (CASP8)
   05161 Hepatitis B
    108398898 (CASP8)
   05160 Hepatitis C
    108398898 (CASP8)
   05164 Influenza A
    108398898 (CASP8)
   05162 Measles
    108398898 (CASP8)
   05168 Herpes simplex virus 1 infection
    108398898 (CASP8)
   05163 Human cytomegalovirus infection
    108398898 (CASP8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108398898 (CASP8)
   05169 Epstein-Barr virus infection
    108398898 (CASP8)
   05165 Human papillomavirus infection
    108398898 (CASP8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108398898 (CASP8)
   05142 Chagas disease
    108398898 (CASP8)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108398898 (CASP8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mjv01002]
    108398898 (CASP8)
Enzymes [BR:mjv01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.61  caspase-8
     108398898 (CASP8)
Peptidases and inhibitors [BR:mjv01002]
 Cysteine peptidases
  Family C14: caspase family
   108398898 (CASP8)
SSDB
Motif
Pfam: Peptidase_C14 DED Dynamin_N PYRIN
Other DBs
NCBI-GeneID: 108398898
NCBI-ProteinID: XP_017518745
LinkDB
Position
Unknown
AA seq 383 aa
MLFQISEDVSKLELRSFKFLLSQKISKCKLDDDMNMLDIFTEMEKRVILGERNLDTLRKI
CDQVNKSLLKKINDYEELSRERRTSLEKSPDELSNDLSQFFMKEKLFEELPMLDSPGVPD
SESQVSIEVYPMKSKPRGYCLIFNNYDFSIARKDVPKLQSIKDRNGTHLDAEALSKTFSD
LHFEIVCYKDSTAKEICEILKSYQKMDHNNRDCFICCILSHGDKGIIYGSDGQEAPIYEL
TSYFTGLRCPSLAGKPKIFFIQACQGDNFQRGIAVETDSKQKEDCLEMDSSFRKKYIPDE
ADFLLGMATVNNYVSYRNPMEGTWYIQSLCQSLRERCPRGEDILAILTKVNFEVSNKDDR
KNMGKQMPQPTFTLRKKLFFPLH
NT seq 1152 nt   +upstreamnt  +downstreamnt
atgctttttcagatttcagaagatgtaagcaaactggaattgaggtcctttaagttcctt
ttgagccagaagatttccaaatgtaaactggatgatgacatgaacatgcttgacattttc
acagagatggagaagagggttattctaggggaaagaaatttggataccctaagaaaaatc
tgtgaccaagtcaacaagagtctgctgaagaaaatcaatgactatgaagaattgagcaga
gaaagaagaacgagccttgaaaaaagtccagatgaactttccaatgatctgtctcaattt
ttcatgaaggaaaaattatttgaagagctgccaatgttagactctccaggagtacccgac
agtgagtcccaggtatcaatcgaagtttacccgatgaaaagcaaaccacgaggttattgt
ttaatcttcaacaattatgattttagtatagcacgaaaggatgtacccaaacttcagagc
attaaggacaggaatggaacacacttggatgcagaggctttgagtaagacctttagtgat
ctccattttgagatagtgtgttacaaagactccacagcaaaggaaatctgtgagattctg
aaatcctaccaaaagatggaccacaataacagggactgcttcatctgctgcatcctctcc
catggagacaaaggaatcatctatggctctgatgggcaggaagcccccatctatgagctg
acctcttacttcactggtttgcggtgcccatcccttgcaggcaaacccaaaatatttttt
attcaggcctgtcaaggggataacttccagagaggtatagctgttgagactgactcaaaa
cagaaggaagactgtttagaaatggactcatcatttcggaagaaatacattccagatgag
gctgactttctgttggggatggccactgtgaacaactatgtttcctaccgaaaccccatg
gaggggacctggtatatccagtcactttgccagagcctgagagaaagatgtcctaggggt
gaagacattctcgccatcctgaccaaagtgaacttcgaagtaagcaacaaggatgacagg
aaaaacatggggaaacaaatgccacaacccactttcacactgagaaaaaagctcttcttc
cctcttcattga

DBGET integrated database retrieval system