KEGG   Manis javanica (Malayan pangolin): 108399139
Entry
108399139         CDS       T06054                                 

Gene name
BMPR1B
Definition
(RefSeq) bone morphogenetic protein receptor type-1B isoform X1
  KO
K13578  bone morphogenetic protein receptor type-1B [EC:2.7.11.30]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04350  TGF-beta signaling pathway
mjv04360  Axon guidance
mjv04390  Hippo signaling pathway
mjv04550  Signaling pathways regulating pluripotency of stem cells
mjv05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    108399139 (BMPR1B)
   04390 Hippo signaling pathway
    108399139 (BMPR1B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108399139 (BMPR1B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    108399139 (BMPR1B)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    108399139 (BMPR1B)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108399139 (BMPR1B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mjv01001]
    108399139 (BMPR1B)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mjv04090]
    108399139 (BMPR1B)
Enzymes [BR:mjv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     108399139 (BMPR1B)
Protein kinases [BR:mjv01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   108399139 (BMPR1B)
CD molecules [BR:mjv04090]
 Proteins
  108399139 (BMPR1B)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase TGF_beta_GS Activin_recp FTA2
Other DBs
NCBI-GeneID: 108399139
NCBI-ProteinID: XP_017519213
LinkDB
Position
Unknown
AA seq 532 aa
MGWLEEPSRQLHISLLILLSMHTRANLLDNMLLRSSGKLNVGTKKEDGESTAPTPRPKVL
RCKCHHHCPEDSVNNICSTDGYCFTMIEEDDSGMPVVTSGCLGLEGSDFQCRDTPIPHQR
RSIECCTERNECNKDLHPTLPPLKNRDFVDGPIHHKALLISVTVCSLLLVLIIVFCYFRY
KRQETRPRYSIGLEQDETYIPPGESLRDLIEQSQSSGSGSGLPLLVQRTIAKQIQMVKQI
GKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTG
SWTQLYLITDYHENGSLYDYLKSTTLDTKSMLKLAYSSVSGLCHLHTEIFSTQGKPAIAH
RDLKSKNILVKKNGTCCIADLGLAVKFISDTNEVDIPPNTRVGTKRYMPPEVLDESLNRN
HFQSYIMADMYSFGLILWEVARRCVSGGIVEEYQLPYHDLVPSDPSYEDMREIVCIKKLR
PSFPNRWSSDECLRQMGKLMTECWAHNPASRLTALRVKKTLAKMSESQDIKL
NT seq 1599 nt   +upstreamnt  +downstreamnt
atgggttggctggaggaaccaagccggcagcttcacatttccttgctcattcttctgtct
atgcacacgagggcaaacttgcttgataacatgcttttgcgaagttcaggaaaattaaat
gtgggcaccaagaaagaggacggtgagagtacagcccccacccctcgtccaaaggtcttg
cgttgtaaatgccaccaccactgtccagaagattccgtcaacaatatttgcagcacagat
ggctattgtttcacaatgatagaagaagatgattctggaatgcctgtggtcacttctgga
tgtctaggactagaaggctctgattttcagtgtcgggacactcccattcctcatcagaga
agatcaattgaatgctgcacagaacggaatgaatgtaataaagatctacatcctactctg
cctccactgaaaaacagagattttgttgatggacctatacatcacaaggccttactaata
tctgtgactgtctgtagtttgctcttggtccttatcattgtattctgttatttcaggtat
aaaagacaagaaactagaccacggtacagcattgggttagaacaggacgaaacttacatt
cctcctggggaatccctgagagacttaatcgagcagtctcagagctcaggaagtggatca
ggactccctctgctggtccaaaggactatagctaagcagattcagatggtgaaacagatt
ggaaaaggtcgctatggggaagtttggatgggaaagtggcgtggcgaaaaggtagctgtg
aaagtattcttcaccacagaggaagccagctggttccgtgagacagaaatatatcagaca
gtgttgatgaggcatgaaaacattttggggttcattgctgcagatatcaaagggacaggg
tcatggacccagctgtacctcatcactgactatcatgaaaatggttccctctatgattat
ctgaagtccaccaccctagatactaaatcgatgctgaagttagcctattcttcggtcagt
ggcttgtgtcatttacatactgagatctttagcactcaaggcaaaccagcaattgcccat
cgagatctgaaaagtaagaacatcctggtgaagaaaaatggaacttgctgtatagctgac
ctaggcttggctgtaaaatttattagtgatacaaatgaagttgacataccacccaacacc
cgagtcggcaccaagcggtacatgcctccggaagtgctggatgagagcttgaatagaaat
cacttccagtcgtacatcatggccgacatgtacagttttggactcatcctttgggaggtt
gccaggagatgtgtatcaggaggtatagtggaagaataccagcttccctatcatgatcta
gtgcccagtgacccctcctatgaggacatgagagagattgtgtgcatcaagaagctgcgg
ccctcattccccaatcggtggagcagcgatgagtgcctaaggcagatggggaagctcatg
acagaatgctgggctcacaatcctgcgtcgagactgacagccctgcgtgttaagaaaaca
cttgccaaaatgtcagagtcccaggacattaaactctga

DBGET integrated database retrieval system