KEGG   Manis javanica (Malayan pangolin): 108399551
Entry
108399551         CDS       T06054                                 

Gene name
ABCC2
Definition
(RefSeq) canalicular multispecific organic anion transporter 1
  KO
K05666  ATP-binding cassette, subfamily C (CFTR/MRP), member 2
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01523  Antifolate resistance
mjv01524  Platinum drug resistance
mjv02010  ABC transporters
mjv04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    108399551 (ABCC2)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    108399551 (ABCC2)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108399551 (ABCC2)
   01523 Antifolate resistance
    108399551 (ABCC2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mjv02000]
    108399551 (ABCC2)
Transporters [BR:mjv02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC1, 2, 3, 4, 5, 6, 10, 11, 12, 13 subgroups
    108399551 (ABCC2)
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N MMR_HSR1 RsgA_GTPase AAA_29 AAA_16 MeaB Dynamin_N AAA_24 DUF2884 FKBP_N_2
Other DBs
NCBI-GeneID: 108399551
NCBI-ProteinID: XP_017519870
LinkDB
Position
Unknown
AA seq 1544 aa
MLETFCNSTFWNSSFLDSPEVDLPLCFEQTVLVWIPLGFLWLLAPWQLLHVYRSRTKRSP
ITKLYLAKQVLVVFLLILAAIELALVLTEDSGQATVPAIRYTNPSLYLATWLLVLLIQHS
RRWCVQKDSWFLSLFWILSILCGTFQFQTLIRTLLKDSNSNLAYSCLYFICYAFQILTLI
LSAFSEKDDSSNNPSSTASFLSRITFSWFDSVVLKGYKQPLTLEDVWDVDEEIKTKTLVS
KFEKCMARELQKARQAFQRRQEKNSRQNSGDRLHGLNKNQSQSQDVLVLEEAKKKKKKSG
TTEDFPKSWLVKALFKTFYMVLLKSLLLKLLHDIFIFANPQLLKLLISFANDRDSYVWTG
YLCSVLLFAVALFQSICLQYYFQLCFVLGMHVRTTIMASVYKKALTLSNRAKKRYTIGET
VNLMSVDAQKLMDVTSYIHMLWSNVLQIILSIYFLWIELGPSVLAGVGVMVLLIPVNGIL
ATKSKTIQVKNMKNKDKRLKIMNEILSGIKILKYFAWEPSFKNKIHDLRKKELKNLLTFG
QIQSIIVFLLFLTPVLVSVITFSVYTLVDSNNILDAQKAFTSITVFNILRFPLSMLPMVI
TSMLQASVSTERLEKYLGGDDLDTSAIRHDCNFDKAVQFSEASFTWDQDLEATVRNVNLD
IIPGQLVAIVGAVGAGKSSLMSAMLGEMENVHGHITIKGTIAYVPQQSWIQNGTIKDNIL
FGSELNEKRYQQILEACALLQDLEVLPGGDQAEIGEKGINLSGGQKQRISLARATYQNSD
IYILDDPLSAVDAHVGKHIFNKILGPNGLLKGKTRLLVTHSIHFLPQVDEIVLLGDGTIL
EKGSYSALLAKKGLFAKNLNTFIKQTGPEGEATVNEDSEGEGDCGLIPSMEEIPEDAVSL
TMKRENSLHQTLRHSSRSSRRHPKSLKLSLKTQNVKTLKEDEAPVKGQRLIEKEFIQTGK
VNFSIYLKYLRAVGWYSIFFIIFAYMINSAAFIGSNIWLSNWTNDSKAFNSTNYPASQRD
MRVGVYGALGVIQGVFVLIANLWSARGSTHASNILHKQLLNNIIRAPMSFFDTTPTGRIV
NRFAGDISTVDDTLPMSLRSWVLCFLGIISTLVMICMAAPVFILIILPLTIVYVSVQILY
MATSRQLRRLDSVTRSPIYSHFSETVSGLSVIRAFEHQQRFLKRSEVGIDTNQKCVYSWI
TSNRWLAVRLELVGNLIVFFSSLLMVIYRDSLSGDTVGFVLSNALNITQTLNWLVRTSSE
IETNIVAVERINEYIKVENEAPWVTDKRPPAGWPSKGEIQFSDYQVRYRPELDLVLKGIT
CNMRSAEKIGVVGRTGAGKSSLTNGLFRILEAEGGQITIDGVDIASIGLHDLREKLTIIP
QEPILFSGSLRMNLDPFSSYSDEEIWRALELAHLQSFVAGLQLGLSHEVAEAGDNLSIGQ
RQLLCLARALLRKSKILIMDEATAAVDLETDRLIQMTIQNEFSHCTTITIAHRLHTIMDS
DKVMVLDNGKIVEYGSPEELLKNPGPFYYMAKEAGIESVTSTTF
NT seq 4635 nt   +upstreamnt  +downstreamnt
atgctggagacgttctgcaactctaccttttggaattcctcattcctggatagcccggag
gtggacctgccactttgttttgagcaaactgttctggtgtggattcccttgggtttcctt
tggctcctggccccttggcagcttctccatgtatatagatccaggaccaagagatctcct
ataaccaaactctaccttgctaagcaggtgcttgttgtgttccttcttattttagcagct
atagagctggcccttgtactcacagaagactctggacaagccacagtccctgccattaga
tataccaacccaagcctttacctggccacatggctcctggttttgctgatccaacacagc
aggcgatggtgtgtgcagaaggactcttggttcctatccctattctggattctctcaata
ctctgtggcactttccaatttcaaactctgatccggacactcttaaaggacagcaattct
aatctggcctactcctgcctgtacttcatctgctatgcattccagatcctgaccctgatc
ctttcagcattttcagaaaaggatgactcatcaaataatccatcatccacagcttcattt
ctgagtagaattacctttagttggtttgacagtgttgttctgaaaggctacaagcaacct
ctgacacttgaagatgtctgggatgttgatgaagagattaaaaccaagacacttgtcagc
aagtttgaaaagtgcatggcaagagagctgcagaaggccaggcaggcattccagagacgg
caggaaaagaactcccggcagaactctggcgacaggctgcatgggttgaacaagaatcag
agtcaaagtcaagatgtccttgtgctggaagaagctaaaaagaaaaaaaagaagtctggc
accacagaagactttcccaagtcctggttggtgaaggccctcttcaaaaccttctacatg
gtgctcctgaaatcattactcctgaagctactgcatgacatcttcatatttgcgaaccct
cagctgctgaaacttctgatctccttcgcaaatgaccgggactcgtatgtgtggactggg
tatctctgttcagtcctcttgttcgccgtggccctcttccagtccatctgcctgcagtat
tactttcaactgtgcttcgtgctgggcatgcatgtgcggacaaccatcatggcttctgtg
tataagaaggcattgaccctgtccaaccgggccaagaagcggtacaccattggagaaact
gtgaacctgatgtctgtggatgcccagaagctcatggacgtgaccagctacatccacatg
ctgtggtcaaatgttctgcaaattatcttatctatctacttcctgtggatagagctggga
ccctcagtcttagcaggtgttggggtgatggtacttctaatcccagttaatgggatacta
gccaccaagagtaagaccattcaggtaaaaaacatgaagaataaagacaaacgtttaaag
atcatgaatgagattctcagtgggatcaagatcctgaaatattttgcctgggaaccttca
ttcaaaaacaaaatccacgatcttcggaagaaagagctcaagaacctgctgacctttggg
cagatacaatctataatagtatttctcttattcttaactccagtcctggtgtctgtgatc
acattttcagtttacaccctggtggatagcaataacattttggatgcacaaaaggccttt
acctccatcacagttttcaatatcctgcgttttcccttgagcatgcttcccatggttatc
acctctatgctccaggccagtgtttccacagaacggctagagaagtacctgggaggggat
gacttggacacatctgctattcgacatgactgcaattttgacaaagctgtgcagttttcc
gaggcctcctttacctgggaccaggatttagaagccacagtccgaaatgtgaacctggac
attataccaggccagctggtggctatagtgggtgcagtgggtgctgggaaatcctccttg
atgtcagccatgctgggagaaatggaaaatgtccatgggcacatcaccatcaagggcacc
atagcctacgtcccacagcagtcctggatccagaatggcaccataaaggacaacatcctc
tttggatcagaattgaatgaaaagagataccagcaaattctggaggcctgtgcactcctc
caagacttggaagtgctgcctggaggagaccaggctgagattggagagaagggtataaat
ctcagtggaggtcagaagcagcggatcagcctggccagagctacctatcaaaattcagac
atctatattctggatgaccccctgtcagctgtggatgctcatgtgggaaaacatattttc
aataaaatcttgggtcccaatggcctattgaaaggcaagacccgcctcttggttacgcac
agcattcactttcttccccaagtggatgagattgtgcttctgggcgatggcaccatcttg
gagaaagggtcctacagcgctctgctggccaagaaaggattgtttgctaagaatctaaac
acattcataaaacagacgggtcctgaaggagaggccacagtcaatgaagacagtgaagga
gaaggggactgcgggctgatacccagtatggaggaaatccctgaggatgcagtctccttg
accatgaagagagagaacagcctccatcaaacacttagacacagttctaggtccagcaga
aggcatccaaagtccctgaaactctccctgaaaactcagaatgtgaaaaccttgaaagaa
gatgaagcaccagtgaaaggacagagactaatcgagaaggaattcatacaaactggaaag
gtgaacttctccatctacctgaaatatctacgagcagtaggatggtattcgatattcttc
atcatctttgcctatatgatcaattctgcggcttttattggatccaacatttggctcagt
aattggaccaatgactctaaagccttcaacagcaccaactatccagcctctcagagggac
atgagagttggtgtctatggagctctgggagtaattcaaggtgtatttgtgctcatagca
aatctctggagtgcccgtggttccacccatgcatcaaatatccttcacaaacaactactg
aataatatcatccgagcacccatgagtttttttgacacaacacccacaggccggattgtg
aacaggtttgctggggatatctccacggtggatgataccctccccatgtccttgcgcagc
tgggtcttgtgcttcctggggatcatcagcacccttgtcatgatctgcatggccgcccca
gtcttcatcctcatcatccttcctctcaccatcgtttatgtgtctgttcagatactttac
atggccacttcccgccagctgagacgtctggactctgtcaccaggtccccaatctactcc
cacttcagtgagactgtgtcaggtttgtctgtcatccgtgcctttgagcatcagcagcgg
tttctaaaacgcagtgaggtggggattgacaccaaccagaagtgtgtctactcctggatt
acctccaacaggtggcttgcggttcggctggagctggttggaaacctgatcgtcttcttt
tcatccttgctgatggttatctatagagacagcctaagtggggacactgtgggctttgtt
ctgtccaatgcactcaatatcacacagaccctgaactggctagtgaggacgtcgtcagaa
atagaaaccaacattgtggctgttgagagaataaatgagtacataaaagtggaaaatgag
gcaccctgggtgactgataaaaggcctccagcaggttggcccagcaaaggggagatccag
tttagcgactaccaagtacggtaccggcctgagttggatctggtcctgaaagggatcact
tgtaacatgaggagtgcagagaagattggtgtggtgggcaggacaggagctgggaagtca
tccctgacaaatggcctcttcagaatcctggaggctgaaggtggccagatcaccattgat
ggggtagatattgcttccattgggctccacgatctccgagagaaactgaccatcatcccc
caggagcccatcctgttctctgggagcctgaggatgaacctagaccctttcagcagctac
tcagatgaggagatctggagggccctggagctggctcacctccagtcctttgtggctggc
ctgcagcttgggctgtctcatgaagtggcagaggcaggtgacaacctgagcatagggcag
aggcagctactctgcctggccagggctctactccggaaatccaagattctgatcatggat
gaggccaccgctgcagtggatctagagacggatcgcctcatccagatgaccattcaaaac
gaattctcccactgcacaaccatcaccattgcccacaggctgcacaccatcatggacagc
gacaaagtaatggttctagacaatgggaagattgtagagtatggcagccctgaagaactg
ctgaaaaaccctggccccttttattatatggccaaagaagctggcattgaaagtgtgacc
agcacaacgttctga

DBGET integrated database retrieval system