KEGG   Manis javanica (Malayan pangolin): 108399811
Entry
108399811         CDS       T06054                                 

Gene name
PDPK1
Definition
(RefSeq) 3-phosphoinositide-dependent protein kinase 1 isoform X1
  KO
K06276  3-phosphoinositide dependent protein kinase-1 [EC:2.7.11.1]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01524  Platinum drug resistance
mjv03320  PPAR signaling pathway
mjv04068  FoxO signaling pathway
mjv04071  Sphingolipid signaling pathway
mjv04140  Autophagy - animal
mjv04150  mTOR signaling pathway
mjv04151  PI3K-Akt signaling pathway
mjv04152  AMPK signaling pathway
mjv04210  Apoptosis
mjv04510  Focal adhesion
mjv04660  T cell receptor signaling pathway
mjv04664  Fc epsilon RI signaling pathway
mjv04722  Neurotrophin signaling pathway
mjv04910  Insulin signaling pathway
mjv04919  Thyroid hormone signaling pathway
mjv04931  Insulin resistance
mjv04960  Aldosterone-regulated sodium reabsorption
mjv05145  Toxoplasmosis
mjv05205  Proteoglycans in cancer
mjv05213  Endometrial cancer
mjv05215  Prostate cancer
mjv05223  Non-small cell lung cancer
mjv05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    108399811 (PDPK1)
   04071 Sphingolipid signaling pathway
    108399811 (PDPK1)
   04151 PI3K-Akt signaling pathway
    108399811 (PDPK1)
   04152 AMPK signaling pathway
    108399811 (PDPK1)
   04150 mTOR signaling pathway
    108399811 (PDPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108399811 (PDPK1)
  09143 Cell growth and death
   04210 Apoptosis
    108399811 (PDPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108399811 (PDPK1)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    108399811 (PDPK1)
   04664 Fc epsilon RI signaling pathway
    108399811 (PDPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    108399811 (PDPK1)
   03320 PPAR signaling pathway
    108399811 (PDPK1)
   04919 Thyroid hormone signaling pathway
    108399811 (PDPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    108399811 (PDPK1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    108399811 (PDPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    108399811 (PDPK1)
   05231 Choline metabolism in cancer
    108399811 (PDPK1)
  09162 Cancer: specific types
   05215 Prostate cancer
    108399811 (PDPK1)
   05213 Endometrial cancer
    108399811 (PDPK1)
   05223 Non-small cell lung cancer
    108399811 (PDPK1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    108399811 (PDPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108399811 (PDPK1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108399811 (PDPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mjv01001]
    108399811 (PDPK1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mjv04131]
    108399811 (PDPK1)
Enzymes [BR:mjv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108399811 (PDPK1)
Protein kinases [BR:mjv01001]
 Serine/threonine kinases: AGC group
  PDK1 family
   108399811 (PDPK1)
Membrane trafficking [BR:mjv04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    108399811 (PDPK1)
SSDB
Motif
Pfam: Pkinase PH_3 PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal APH Kdo YukC
Other DBs
NCBI-GeneID: 108399811
NCBI-ProteinID: XP_017520303
LinkDB
Position
Unknown
AA seq 574 aa
MTHAPTSFLLVPRPWEDWAPARCSYDTVPIQSSVVLCACPSPSMVRTQTESGPAPGIPSG
GSRQGPTMDSTAAEARPSTNSRQHTTQPLPQPRKKRPEDFKFGKILGEGSFSTVVLAREL
ATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYA
KNGELLKYIRKIGSFDETCTRFYTAEMVSALEYLHGKGIIHRDLKPENILLNEDMHIQIT
DFGTAKVLSPESKQARANSFVGTAQYVSPELLTEKSACKSSDLWALGCIVYQLVAGLPPF
RAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYAPLKAHPFF
ESITWEDLRHQTPPKLTAYLPAMSEDDEDCYGNYDNLLSQFGCMQVSSSSSSHSLSATDT
GPPQRAGSNIEQYIHDLDTNSFELDLQFSEDEKRLLLEKQANGNPWHQFVENNLILKMGP
VDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRT
YYLMDPSGNAHKWCKKIQEVWRHRYQSPPGAAVQ
NT seq 1725 nt   +upstreamnt  +downstreamnt
atgacccatgcgccgacttcttttcttctggtccctagaccctgggaggactgggctcct
gctcgttgctcatatgacaccgttcctattcagtccagcgtggtgttatgtgcctgtcca
tccccatccatggtgaggacccagacagagtccggcccggcccccggcatccccagcggt
ggcagcaggcagggccccaccatggacagcaccgcggccgaggcccgtccgagcaccaac
tcccggcagcacaccacacagcctctgccacagcctcgaaagaaacggcctgaagacttc
aaatttgggaaaattcttggtgaaggctctttctcaacagttgttctggcccgagaactg
gcaacctcaagggaatatgctattaaaattctagagaaacgtcacattatcaaagagaac
aaggtcccatatgtaaccagagaaagagacgtgatgtcgcgcctggatcaccccttcttt
gttaaactttacttcacgtttcaggatgatgaaaagctgtattttggccttagctatgcc
aaaaatggagaactgcttaaatacattcgcaaaattggctcatttgatgagacttgcacc
cgcttttacacggctgagatggtgtctgcactggagtacctgcacggcaagggcatcatt
cacagggacctcaaaccagaaaacattttgttaaacgaagacatgcacatccagatcaca
gattttggaacagcaaaagtactgtccccagagagcaaacaagccagggccaactcgttt
gtaggaacagcccagtatgtttctccagagctgctcacagagaaatcggcctgtaaaagt
tcagacctctgggcccttggatgcatcgtctaccagcttgtggcaggcctgccgccattc
cgagccgggaacgaatatcttatatttcagaagattattaagctggaatatgacttccct
gaaaaattcttccctaaggcaagagaccttgtggaaaaacttctggttttagatgccaca
aaacgtttgggctgtgaagaaatggaagggtatgcccctctgaaggcccacccattcttt
gagtccatcacatgggaggacctgcgccatcagacgccgcccaagctcactgcctactta
ccagccatgtcggaagatgacgaagactgctatggaaattatgacaatctcctgagccag
tttggctgcatgcaggtgtcgtcctcatcgtcctctcactccctgtctgccacggacacg
gggccgccccagagggcaggcagcaacatcgagcagtacatccacgacctggacactaat
tcttttgaactggacttacagttttctgaggatgagaagaggttattattggagaagcag
gccaatggaaacccctggcaccagtttgtagaaaataatttaatactaaaaatgggtcca
gtagataagcgaaagggtttatttgctcgacgacgacagttactgctcacagaagggccg
cacttatattatgtggatcctgtcaacaaagtcctgaaaggtgaaatcccatggtcacaa
gaactccgaccagaggctaagaattttaaaaccttctttgtccacacgccgaacaggacg
tattacctgatggacccgagcgggaatgctcacaagtggtgcaaaaagatccaggaagtg
tggaggcacagataccagagccccccgggggctgccgtgcagtga

DBGET integrated database retrieval system