KEGG   Manis javanica (Malayan pangolin): 108399996
Entry
108399996         CDS       T06054                                 

Gene name
MYC
Definition
(RefSeq) myc proto-oncogene protein
  KO
K04377  Myc proto-oncogene protein
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04010  MAPK signaling pathway
mjv04012  ErbB signaling pathway
mjv04110  Cell cycle
mjv04151  PI3K-Akt signaling pathway
mjv04218  Cellular senescence
mjv04310  Wnt signaling pathway
mjv04350  TGF-beta signaling pathway
mjv04390  Hippo signaling pathway
mjv04550  Signaling pathways regulating pluripotency of stem cells
mjv04630  JAK-STAT signaling pathway
mjv04919  Thyroid hormone signaling pathway
mjv05132  Salmonella infection
mjv05160  Hepatitis C
mjv05161  Hepatitis B
mjv05163  Human cytomegalovirus infection
mjv05166  Human T-cell leukemia virus 1 infection
mjv05167  Kaposi sarcoma-associated herpesvirus infection
mjv05169  Epstein-Barr virus infection
mjv05200  Pathways in cancer
mjv05202  Transcriptional misregulation in cancer
mjv05205  Proteoglycans in cancer
mjv05206  MicroRNAs in cancer
mjv05210  Colorectal cancer
mjv05213  Endometrial cancer
mjv05216  Thyroid cancer
mjv05219  Bladder cancer
mjv05220  Chronic myeloid leukemia
mjv05221  Acute myeloid leukemia
mjv05222  Small cell lung cancer
mjv05224  Breast cancer
mjv05225  Hepatocellular carcinoma
mjv05226  Gastric cancer
mjv05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108399996 (MYC)
   04012 ErbB signaling pathway
    108399996 (MYC)
   04310 Wnt signaling pathway
    108399996 (MYC)
   04350 TGF-beta signaling pathway
    108399996 (MYC)
   04390 Hippo signaling pathway
    108399996 (MYC)
   04630 JAK-STAT signaling pathway
    108399996 (MYC)
   04151 PI3K-Akt signaling pathway
    108399996 (MYC)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108399996 (MYC)
   04218 Cellular senescence
    108399996 (MYC)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    108399996 (MYC)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    108399996 (MYC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108399996 (MYC)
   05202 Transcriptional misregulation in cancer
    108399996 (MYC)
   05206 MicroRNAs in cancer
    108399996 (MYC)
   05205 Proteoglycans in cancer
    108399996 (MYC)
   05230 Central carbon metabolism in cancer
    108399996 (MYC)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108399996 (MYC)
   05225 Hepatocellular carcinoma
    108399996 (MYC)
   05226 Gastric cancer
    108399996 (MYC)
   05216 Thyroid cancer
    108399996 (MYC)
   05221 Acute myeloid leukemia
    108399996 (MYC)
   05220 Chronic myeloid leukemia
    108399996 (MYC)
   05219 Bladder cancer
    108399996 (MYC)
   05213 Endometrial cancer
    108399996 (MYC)
   05224 Breast cancer
    108399996 (MYC)
   05222 Small cell lung cancer
    108399996 (MYC)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108399996 (MYC)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108399996 (MYC)
   05161 Hepatitis B
    108399996 (MYC)
   05160 Hepatitis C
    108399996 (MYC)
   05163 Human cytomegalovirus infection
    108399996 (MYC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108399996 (MYC)
   05169 Epstein-Barr virus infection
    108399996 (MYC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mjv03000]
    108399996 (MYC)
   03019 Messenger RNA biogenesis [BR:mjv03019]
    108399996 (MYC)
Transcription factors [BR:mjv03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    108399996 (MYC)
Messenger RNA biogenesis [BR:mjv03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     108399996 (MYC)
SSDB
Motif
Pfam: Myc_N Myc-LZ HLH
Other DBs
NCBI-GeneID: 108399996
NCBI-ProteinID: XP_017520596
LinkDB
Position
Unknown
AA seq 439 aa
MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQHQQQSELQPPAPSEDIWKKFELLPTPP
LSPSRRSGLCSPSYVAVASFSPRGDDDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPD
DETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPSLPRGPGGCSTSSLYLQD
LSTAASECIDPSVVFPYPLNDSSSPKPCASPDSAAFSSSSDSLLSSAESSPRASPEPLAL
HEETPPTTSSDSEEEQEDEEEIDVVSVEKRQPPAKRSESGSSASGGHSKPPHSPLVLKRC
HVSTHQHNYAAPPSTRKDYPAAKRAKLDSGRVLKQISNNRKCTSPRSSDTEENDKRRTHN
VLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSIQAEEQKLISEKDLL
RKRREQLKHKLEQLRNSCA
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgcccctcaacgtcagcttcaccaacaggaactatgacctcgactacgactcggtgcag
ccgtatttctactgcgacgaggaggagaacttctaccagcaccagcagcagagcgagctg
cagccaccggcgcccagcgaggatatctggaagaaattcgagctgctgcccaccccgccc
ctgtctccgagccgccgttcggggctctgctcgccctcctacgtcgcggtggcgtccttc
tcccctaggggagacgacgatggcggcggcggcagcttttccacggccgaccagttggaa
atggtgaccgagctgttgggaggagacatggtgaaccagagcttcatctgcgacccggac
gacgagaccttcatcaaaaacatcatcatccaggactgtatgtggagcggcttctcggcc
gccgccaagctcgtctccgagaagctggcctcctaccaggctgcgcgcaaagacagcggc
agcccgagcctcccccgcgggcctggcggctgctccacctccagcctctacctgcaggac
ctgagcaccgccgcctccgagtgcatcgacccctccgtggtcttcccctacccgctcaac
gacagcagctcgcccaagccctgcgcttcccccgactccgccgccttctcctcatcctcg
gactctctgctctcctccgccgagtcctccccgcgggccagccccgagcccctggcgctc
cacgaggagacaccacccaccaccagcagcgactctgaggaagaacaagaggatgaggaa
gaaattgatgttgtttctgtagaaaagaggcagccccctgccaaaaggtcagaatcaggg
tcatctgcttctggaggccacagcaaacctccccacagtccactggtccttaaaagatgc
cacgtgtccacccatcagcacaattatgcagcacccccctccactaggaaggactatcct
gccgccaagagggctaagttggacagtggtagagtcttgaaacagatcagcaacaaccgc
aaatgtaccagccccaggtcctcagacacggaggagaatgacaagaggcggacacacaac
gtcttggaacgccagaggagaaatgagctgaaacggagcttttttgccctgcgtgaccag
atcccggagttggaaaacaatgaaaaggcccccaaggtagttatccttaaaaaagccaca
gcatacatcctgtccatccaagcagaagagcaaaagctcatttcagaaaaggacttgttg
cggaagaggcgagagcagttgaaacacaaacttgaacaactaaggaactcttgtgcgtaa

DBGET integrated database retrieval system