KEGG   Manis javanica (Malayan pangolin): 108400080
Entry
108400080         CDS       T06054                                 

Gene name
STAT1
Definition
(RefSeq) signal transducer and activator of transcription 1-alpha/beta
  KO
K11220  signal transducer and activator of transcription 1
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04062  Chemokine signaling pathway
mjv04217  Necroptosis
mjv04380  Osteoclast differentiation
mjv04620  Toll-like receptor signaling pathway
mjv04621  NOD-like receptor signaling pathway
mjv04625  C-type lectin receptor signaling pathway
mjv04630  JAK-STAT signaling pathway
mjv04658  Th1 and Th2 cell differentiation
mjv04659  Th17 cell differentiation
mjv04917  Prolactin signaling pathway
mjv04919  Thyroid hormone signaling pathway
mjv04933  AGE-RAGE signaling pathway in diabetic complications
mjv04935  Growth hormone synthesis, secretion and action
mjv05140  Leishmaniasis
mjv05145  Toxoplasmosis
mjv05152  Tuberculosis
mjv05160  Hepatitis C
mjv05161  Hepatitis B
mjv05162  Measles
mjv05164  Influenza A
mjv05165  Human papillomavirus infection
mjv05167  Kaposi sarcoma-associated herpesvirus infection
mjv05168  Herpes simplex virus 1 infection
mjv05169  Epstein-Barr virus infection
mjv05171  Coronavirus disease - COVID-19
mjv05200  Pathways in cancer
mjv05212  Pancreatic cancer
mjv05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mjv05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108400080 (STAT1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    108400080 (STAT1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108400080 (STAT1)
   04621 NOD-like receptor signaling pathway
    108400080 (STAT1)
   04625 C-type lectin receptor signaling pathway
    108400080 (STAT1)
   04658 Th1 and Th2 cell differentiation
    108400080 (STAT1)
   04659 Th17 cell differentiation
    108400080 (STAT1)
   04062 Chemokine signaling pathway
    108400080 (STAT1)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    108400080 (STAT1)
   04935 Growth hormone synthesis, secretion and action
    108400080 (STAT1)
   04919 Thyroid hormone signaling pathway
    108400080 (STAT1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108400080 (STAT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108400080 (STAT1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108400080 (STAT1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    108400080 (STAT1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    108400080 (STAT1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    108400080 (STAT1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    108400080 (STAT1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    108400080 (STAT1)
   05160 Hepatitis C
    108400080 (STAT1)
   05171 Coronavirus disease - COVID-19
    108400080 (STAT1)
   05164 Influenza A
    108400080 (STAT1)
   05162 Measles
    108400080 (STAT1)
   05168 Herpes simplex virus 1 infection
    108400080 (STAT1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108400080 (STAT1)
   05169 Epstein-Barr virus infection
    108400080 (STAT1)
   05165 Human papillomavirus infection
    108400080 (STAT1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108400080 (STAT1)
   05140 Leishmaniasis
    108400080 (STAT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mjv03000]
    108400080 (STAT1)
Transcription factors [BR:mjv03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    108400080 (STAT1)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int STAT1_TAZ2bind SH2 TRPM_tetra DUF4407 DUF1633
Other DBs
NCBI-GeneID: 108400080
NCBI-ProteinID: XP_017520763
LinkDB
Position
Unknown
AA seq 750 aa
MSQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDL
LSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPILMSMIIYNCLKEERKILENAQ
RFNQAQSGNIQSTVMLDKQKELDSKVRNVKDKVMCIEHEIKTLEDLQDEYDFKCKTLQNR
EHETNGVAKNDQKQEQMLLQKMYLMLDSKRKEVVHKIIELLNVTELTQKALIHDELVEWK
QRQQSACIGGPPNACLDQLQNWFTIVAESLQQVRQQLKKLEELEQKYTYEHDPITKNKQG
LWDRTFSLFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVKLQELNYNLKV
KVLFDKDVNERNTVKGFRKFNILGTHTKVMNMEESTNGSLAAEFRHLQLKEQKNAGTRTN
EGPLIVTEELHSLSFETQLCQPGLVIDLETTSLPVVVISNVSQLPSGWASILWYNMLVAE
PRNLSFFLNPPCARWSQLSEVLSWQFSSVTKRGLNVDQLSMLGEKLLGPNAGPDGLIPWT
RFCKENINDKNFPFWLWIESILELIKKHLLSLWNDGCIVGFISKERERALLKDQQPGTFL
LRFSESCREGAITFTWVERSQNGGEPYFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIP
ENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDGPKGTGYIKTELISVSEVHPSRLQTT
DNLLPMSPEEFDEVSRIVGPVEFDSMMNAV
NT seq 2253 nt   +upstreamnt  +downstreamnt
atgtcccagtggtatgagcttcagcagcttgattccaaattcctggagcaagttcaccag
ctctatgatgacagttttcccatggaaatcagacagtatcttgcacagtggctagaaaaa
caagactgggagcatgccgccaatgatgtttcatttgctaccatccgttttcatgacctc
ctgtcacagctagatgatcagtacagccgcttttctttggagaataattttttattgcaa
cataacataaggaagagcaagcgtaatcttcaggataattttcaggaagacccaatactg
atgtctatgatcatctataactgtctgaaggaggaaaggaagatactggaaaatgcccag
agattcaaccaggcccagtcaggaaatattcagagcactgtgatgttagacaaacagaag
gagcttgacagcaaagtcagaaatgtgaaggacaaagttatgtgtatagagcatgaaatc
aagacgctagaagatttgcaagatgaatatgactttaaatgcaaaaccttgcagaacaga
gaacatgaaaccaatggtgtggcaaagaatgatcagaaacaagaacagatgttactccag
aagatgtatttaatgcttgacagtaagagaaaggaggttgttcacaaaataatagagttg
ttgaatgtcactgaacttacccagaaagccctgatccatgatgaactggtggagtggaag
cagagacagcagagtgcctgtattggggggccccccaacgcttgccttgatcaactgcag
aactggttcaccatagttgcagagagtctgcaacaggtccgtcagcagcttaaaaagctt
gaggaattggaacagaaatacacctacgaacacgaccctatcacaaaaaacaagcaaggg
ttatgggaccgcaccttcagccttttccagcagctcattcagagctcatttgtggtggaa
agacagccttgcatgccaactcatcctcagaggccattggtcttgaagactggggtacag
ttcactgtgaagttgaggctgttggtgaaattgcaagagctgaattataatttgaaagtc
aaagtgttatttgataaagatgtgaatgagagaaatacagtaaaaggatttagaaagttc
aacattttgggcacacatacaaaagtgatgaacatggaggagtccaccaatggaagtctt
gcggcagaatttcgacacctgcaactgaaagaacagaaaaatgctggcactagaactaat
gagggcccactcatcgttactgaagagcttcattcccttagttttgagacccagttgtgc
cagcctggtttggtcattgacctcgagacaacgtctctgcctgttgtggtgatctccaac
gtcagccagctcccgagtggttgggcctccattctgtggtacaacatgctggtggcagaa
cccaggaatctgtccttcttcctgaacccaccttgtgcacgatggtctcagctgtcggag
gtgctaagctggcagttttcttcggtcaccaaaagggggctcaacgtggatcagctgagt
atgctgggagagaagcttcttggtccgaatgctggccctgacggccttattccgtggaca
aggttctgtaaggaaaatataaatgataaaaattttcctttctggctttggattgaaagc
attcttgaactcattaaaaaacaccttctctctctctggaatgatgggtgcattgtgggc
tttatcagcaaggagcgagaacgcgctctgctaaaggaccagcagcctggcacgttcctg
ctgcgcttcagtgagagctgccgggagggggccatcacgttcacgtgggtggagcggtcc
cagaatggaggcgaaccttacttccatgcggttgaaccctacacaaagaaggaactttct
gctgttactttccctgatattattcgcaactacaaagtcatggctgctgaaaatattcca
gagaatcccctgaagtatctgtatccaaatattgataaagaccatgcctttgggaaatac
tactccaggccaaaggaagcaccagaaccaatggaacttgatggccctaaaggaactgga
tacataaagaccgagctgatttctgtgtctgaagttcacccttctcgccttcagaccaca
gacaaccttctccccatgtctcctgaggagtttgacgaagtctctcgaattgtgggccct
gtggaattcgacagtatgatgaatgcagtgtag

DBGET integrated database retrieval system