KEGG   Manis javanica (Malayan pangolin): 108400081
Entry
108400081         CDS       T06054                                 

Gene name
STAT4
Definition
(RefSeq) signal transducer and activator of transcription 4
  KO
K11222  signal transducer and activator of transcription 4
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04217  Necroptosis
mjv04630  JAK-STAT signaling pathway
mjv04658  Th1 and Th2 cell differentiation
mjv05161  Hepatitis B
mjv05200  Pathways in cancer
mjv05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108400081 (STAT4)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    108400081 (STAT4)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    108400081 (STAT4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108400081 (STAT4)
  09163 Immune disease
   05321 Inflammatory bowel disease
    108400081 (STAT4)
  09172 Infectious disease: viral
   05161 Hepatitis B
    108400081 (STAT4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mjv03000]
    108400081 (STAT4)
Transcription factors [BR:mjv03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    108400081 (STAT4)
SSDB
Motif
Pfam: STAT_alpha STAT_bind SH2 NPV_P10
Other DBs
NCBI-GeneID: 108400081
NCBI-ProteinID: XP_017520766
LinkDB
Position
Unknown
AA seq 649 aa
MHVAVVISNCLREERRILAAANMPVQGPLEKSLQTSSVLERQRNVEHKVAAIKNSVQMTE
QDTKYLEDLQDEFDYRYKTIQTMDQGDKNSALMNQEVLTLQEMLNSLDFKRKEALSKMTQ
IVKETDVLMNNMLLEELHDWKRRQQMACIGGPLHNGLDQLQNCFTLLAESLFQLRRQLEK
LEEQSTKMTYEGDPIPVQRAHLLERVTFLIYNLFKNSFVVERQPCMPTHPQRPMVLKTLI
QFTVKLRLLIKLPELNYQVKVKASIDKSVSTLSNRRFVLCGTHVKAMSTEESSNGSLSVE
FRHLPKEMKSSAGSKGNEGCHMVTEELHSITFETQICLYGLTIDLETSSLPVVMISNVSQ
LPNAWASIIWYNVSTSDCQNLVFFNNPPSATLSQLLEVMSWQFSSYVGRGLNSDQLSMLA
EKLTVQSSYSDGYLTWAKFCKEHLPGKSFTFWTWLEAILDLIKKHILPLWIDGYVMGFVS
KEKERLLLKDKMPGTFLLRFSESHLGGITFTWVDHSENGEVRFHSVEPYNKGRLSALPFA
DILRDYKVIMAENVPENPLKYLYPDIPKDKAFGKHYSSQPCEVSRPTERGDKGYVPSVFI
PISTIRSDSTEPHSPSDLLPMSPSVYAVLRENLSPTTIETAMKSPYSAE
NT seq 1950 nt   +upstreamnt  +downstreamnt
atgcatgtagctgtggttatttcaaattgtttgagggaagagaggagaatattggctgca
gccaacatgcctgttcagggacctctggagaaatccttgcaaacttcttcagttttggaa
agacagagaaatgtggaacacaaagtggctgccattaaaaatagcgtgcagatgacagaa
caagacacaaaatatttagaagacctgcaagatgaatttgactacaggtataaaacaatt
cagacgatggatcagggtgacaagaacagtgccctaatgaatcaggaagttttgactctg
caagaaatgcttaacagccttgactttaaaagaaaggaagctctcagtaaaatgacacaa
atagtaaaagaaacggacgtgttaatgaacaacatgctactagaagagctgcacgattgg
aagaggcggcagcagatggcgtgcattggcggtccactccacaacgggctcgaccagctt
cagaactgctttacactgttggcagaaagtctattccaactcagaaggcaattggagaaa
ttagaggaacaatctaccaaaatgacatacgaaggtgatcccattccagtgcaaagagca
catctgctagaaagagtcactttcttgatctacaacctttttaagaactcatttgtggtt
gaacgacagccatgcatgccaacccaccctcagaggccgatggtacttaaaactctcatt
cagttcactgtaaaactaagactactaataaaattgccagaactaaactatcaggtaaag
gtgaaagcctcaattgacaagagtgtttcaaccctaagcaatagaagatttgtcctttgt
ggaactcatgtcaaagctatgtccactgaagaatcttctaatgggagtctctcggtagaa
tttcgacatttgccaaaggaaatgaagtccagtgctggaagcaaaggaaatgagggctgt
cacatggtgactgaagagcttcattccataacctttgagacacagatctgcctctatggc
ctgaccatagatttggagaccagttcactacctgtggtgatgatttccaatgtcagtcag
ttgcctaatgcttgggcatccatcatttggtacaatgtgtcaaccagtgactgccagaac
ttggttttctttaataatcctccatctgccactctgagccaactcctggaagtgatgagc
tggcagttttcatcatatgtcggccgaggccttaactcagatcaactcagtatgctggca
gagaagctaacagtgcagtctagctacagcgatggttatctcacctgggccaagttctgc
aaggaacatttacctggtaaatcatttaccttttggacatggcttgaagcaatattagat
ctaattaagaaacacattcttcccctttggattgatgggtatgtcatgggctttgttagc
aaagagaaggaaaggcttttgctaaaggataaaatgcctggaacctttttgttaagattc
agtgaaagccaccttggaggaataactttcacctgggtggaccactctgaaaatggagaa
gtgagattccactctgtggaaccctacaataaaggccggttgtctgctctgccattcgct
gacatccttagagactacaaagttattatggctgaaaacgtccctgaaaaccctctgaag
tacctatatcctgacattcccaaagacaaagccttcggtaaacactacagctcccagcca
tgtgaagtttcaagaccaacagaaaggggagacaaaggttatgttccttctgtttttata
cccatttcaacaatccgaagtgattcaactgagccacattctccatcagatcttctacct
atgtctccaagtgtatatgcagtgctgagagaaaacctgagtcccaccaccattgaaact
gcaatgaagtctccatattctgctgaatga

DBGET integrated database retrieval system