KEGG   Manis javanica (Malayan pangolin): 108400315
Entry
108400315         CDS       T06054                                 

Gene name
BAX
Definition
(RefSeq) apoptosis regulator BAX
  KO
K02159  apoptosis regulator BAX
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01521  EGFR tyrosine kinase inhibitor resistance
mjv01522  Endocrine resistance
mjv01524  Platinum drug resistance
mjv04071  Sphingolipid signaling pathway
mjv04115  p53 signaling pathway
mjv04141  Protein processing in endoplasmic reticulum
mjv04210  Apoptosis
mjv04211  Longevity regulating pathway
mjv04215  Apoptosis - multiple species
mjv04217  Necroptosis
mjv04722  Neurotrophin signaling pathway
mjv04932  Non-alcoholic fatty liver disease
mjv04933  AGE-RAGE signaling pathway in diabetic complications
mjv05012  Parkinson disease
mjv05014  Amyotrophic lateral sclerosis
mjv05016  Huntington disease
mjv05020  Prion disease
mjv05022  Pathways of neurodegeneration - multiple diseases
mjv05132  Salmonella infection
mjv05152  Tuberculosis
mjv05160  Hepatitis C
mjv05161  Hepatitis B
mjv05162  Measles
mjv05163  Human cytomegalovirus infection
mjv05164  Influenza A
mjv05165  Human papillomavirus infection
mjv05166  Human T-cell leukemia virus 1 infection
mjv05167  Kaposi sarcoma-associated herpesvirus infection
mjv05168  Herpes simplex virus 1 infection
mjv05169  Epstein-Barr virus infection
mjv05170  Human immunodeficiency virus 1 infection
mjv05200  Pathways in cancer
mjv05202  Transcriptional misregulation in cancer
mjv05203  Viral carcinogenesis
mjv05210  Colorectal cancer
mjv05212  Pancreatic cancer
mjv05213  Endometrial cancer
mjv05214  Glioma
mjv05216  Thyroid cancer
mjv05217  Basal cell carcinoma
mjv05218  Melanoma
mjv05220  Chronic myeloid leukemia
mjv05222  Small cell lung cancer
mjv05223  Non-small cell lung cancer
mjv05224  Breast cancer
mjv05225  Hepatocellular carcinoma
mjv05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    108400315 (BAX)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    108400315 (BAX)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108400315 (BAX)
   04215 Apoptosis - multiple species
    108400315 (BAX)
   04217 Necroptosis
    108400315 (BAX)
   04115 p53 signaling pathway
    108400315 (BAX)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    108400315 (BAX)
  09149 Aging
   04211 Longevity regulating pathway
    108400315 (BAX)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108400315 (BAX)
   05202 Transcriptional misregulation in cancer
    108400315 (BAX)
   05203 Viral carcinogenesis
    108400315 (BAX)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108400315 (BAX)
   05212 Pancreatic cancer
    108400315 (BAX)
   05225 Hepatocellular carcinoma
    108400315 (BAX)
   05226 Gastric cancer
    108400315 (BAX)
   05214 Glioma
    108400315 (BAX)
   05216 Thyroid cancer
    108400315 (BAX)
   05220 Chronic myeloid leukemia
    108400315 (BAX)
   05217 Basal cell carcinoma
    108400315 (BAX)
   05218 Melanoma
    108400315 (BAX)
   05213 Endometrial cancer
    108400315 (BAX)
   05224 Breast cancer
    108400315 (BAX)
   05222 Small cell lung cancer
    108400315 (BAX)
   05223 Non-small cell lung cancer
    108400315 (BAX)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    108400315 (BAX)
   05014 Amyotrophic lateral sclerosis
    108400315 (BAX)
   05016 Huntington disease
    108400315 (BAX)
   05020 Prion disease
    108400315 (BAX)
   05022 Pathways of neurodegeneration - multiple diseases
    108400315 (BAX)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    108400315 (BAX)
   04933 AGE-RAGE signaling pathway in diabetic complications
    108400315 (BAX)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108400315 (BAX)
   05152 Tuberculosis
    108400315 (BAX)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108400315 (BAX)
   05170 Human immunodeficiency virus 1 infection
    108400315 (BAX)
   05161 Hepatitis B
    108400315 (BAX)
   05160 Hepatitis C
    108400315 (BAX)
   05164 Influenza A
    108400315 (BAX)
   05162 Measles
    108400315 (BAX)
   05168 Herpes simplex virus 1 infection
    108400315 (BAX)
   05163 Human cytomegalovirus infection
    108400315 (BAX)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108400315 (BAX)
   05169 Epstein-Barr virus infection
    108400315 (BAX)
   05165 Human papillomavirus infection
    108400315 (BAX)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108400315 (BAX)
   01524 Platinum drug resistance
    108400315 (BAX)
   01522 Endocrine resistance
    108400315 (BAX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mjv03029]
    108400315 (BAX)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mjv02000]
    108400315 (BAX)
Mitochondrial biogenesis [BR:mjv03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    108400315 (BAX)
Transporters [BR:mjv02000]
 Other transporters
  Pores ion channels [TC:1]
   108400315 (BAX)
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 108400315
NCBI-ProteinID: XP_017521110
LinkDB
Position
Unknown
AA seq 192 aa
MDGSGEQPRDGGPTSSEQIMKTGALLLQGFIQDRAGPMVGETPELALEQIPQDASTKKLS
ECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKL
VLKALCTKVPELIRTIMGWTMDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGV
LTASLTIWKKMG
NT seq 579 nt   +upstreamnt  +downstreamnt
atggacgggtccggggagcaacccagagacggggggcccaccagctctgagcagatcatg
aagacaggggcccttttgcttcagggtttcatccaggatcgagcagggccaatggtgggg
gagacacctgagctggccttggagcagattccccaggatgcctccaccaagaagctgagc
gagtgtctcaagcgtatcggagatgaactggacagtaacatggagctgcaaaggatgatt
gcagctgtcgacacagactccccccgcgaggtctttttccgagtggcagccgatatgttt
tccgacggcaacttcaactggggccgggtagtcgccctcttctactttgccagcaaactg
gtgctgaaggccctgtgcaccaaggtgcccgaactgattaggaccatcatgggctggaca
atggacttccttcgagagcggctgctgggctggatccaggaccagggtggttgggatggc
cttctctcctactttgggacacccacgtggcagaccgtgaccatctttgtggctggagtg
ctcacggcatcgctcaccatctggaagaagatgggctga

DBGET integrated database retrieval system