KEGG   Manis javanica (Malayan pangolin): 108400380
Entry
108400380         CDS       T06054                                 

Gene name
PIAS3
Definition
(RefSeq) E3 SUMO-protein ligase PIAS3 isoform X1
  KO
K16064  E3 SUMO-protein ligase PIAS3 [EC:2.3.2.-]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04120  Ubiquitin mediated proteolysis
mjv04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    108400380 (PIAS3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108400380 (PIAS3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mjv04121]
    108400380 (PIAS3)
Enzymes [BR:mjv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     108400380 (PIAS3)
Ubiquitin system [BR:mjv04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   108400380 (PIAS3)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse
Other DBs
NCBI-GeneID: 108400380
NCBI-ProteinID: XP_017521212
LinkDB
Position
Unknown
AA seq 628 aa
MAELGELKHMVMSFRVSELQVLLGFAGRNKSGRKHELLAKALHLLKSSCAPSVQMKIKEL
YRRRFPRKNLGPSDLSLLSLPPGTPPVGSPGPLAPIPSALLAPGSVLGPKCEVDIHPPLP
QPVHPDVTMKPLPFYEVYGELIRPTTLASTSSQRFEEAHFTFALTPQQVQQILTSREVLP
GAKCDYTIQVQLRFCLCETSCPQEDYFPPNLFVKVNGKLCPLPGYLPPTKNGAEPKRPSR
PISITPLARLSATVPNTIVVNWSSEFGRNYSLSVYLVRQLTAGTLLQKLRAKGIRNPDHS
RALIKEKLTADPDSEVATTSLRVSLMCPLGKMRLTVPCRALTCAHLQSFDAALYLQMNEK
KPTWTCPVCDKKAPYESLIIDGLFMEILNSCSDCDEIQFMEDGSWCPMKPKKEASEVCPP
PGYGLDGLQYSPVQEGNPSENKKKVEVIDLTVESSSDEEDLPPTKKHCPVTSAVIAALPG
SKGVLTPGHQPSSVRRSPAVGTLGGDFLSSLPLHEYPPAFPLGADIQGLDLFSFLQTEGQ
HYGPSVITSLDEQDALGHFFQYRGTPSHFLSPLAPTLGSSHRSTTPAPPPGRVSSIVAPG
GALREGHGGPLPLGPSLTDCRSDIISLD
NT seq 1887 nt   +upstreamnt  +downstreamnt
atggcggagctgggcgaattaaagcacatggtgatgagtttccgggtctctgagctccag
gtgcttctcggctttgctggccggaacaagagtggacggaagcacgagctcttggccaag
gccctgcacctcctcaagtctagctgtgcccctagtgtccagatgaagatcaaagaactt
taccgccgccgctttccccggaagaacctagggccctctgatctctctttgctctctctg
ccccctggcacccctcctgtaggctcccctggtcctctagctcctatcccctcggccctc
ttggcccctggttctgtgctgggtcccaagtgtgaagtagacattcacccacctctgccg
cagcctgtgcaccctgatgtcaccatgaaaccgctgcccttctatgaagtctacggggag
cttatccggcccacgacccttgcatccacttcaagccagcggtttgaggaagcccacttt
acattcgccctcacgccacagcaagtgcagcagattctcacgtccagagaggttctgcca
ggagccaaatgcgattataccatacaggtgcagctaaggttctgtctctgtgagaccagt
tgcccacaggaggattatttcccccccaacctctttgtcaaggtcaatgggaaactgtgc
cccctgccgggttaccttcccccaaccaagaatggggctgagcccaagaggcccagccgc
cccatcagcattacacccctggcccgtctctcagccactgttcccaacaccatcgtggtc
aactggtcatctgagtttggacggaattactccttgtctgtgtacctggtgaggcagttg
actgcagggacccttctacaaaaactcagagcaaagggcatccggaacccagatcactcc
cgggcactgatcaaggagaaattgaccgctgacccggacagtgaggtggccactacaagt
ctccgggtgtcactcatgtgcccgctcgggaagatgcgcctaactgttccttgtcgagcc
ctcacctgtgcccacctgcagagctttgatgctgccctttatctgcagatgaatgagaag
aagccaacgtggacatgtcctgtctgtgacaagaaagctccctatgaatctcttatcatt
gatggtttattcatggagattcttaattcctgctcggattgtgatgagatccagttcatg
gaagatgggtcctggtgtccaatgaaacccaagaaggaggcatctgaggtttgcccccca
ccagggtatgggctggatggcctccagtacagcccagtccaagagggcaatccatcagaa
aataagaagaaagtcgaagttattgatttgacagtcgaaagctcatcagatgaagaggat
ctgcccccaaccaaaaagcactgtcctgtcacctcagctgtcatcgcggccctacctgga
agcaaaggggtcctgacacctggtcaccagccatcttcagtgcgtcggagccctgctgtg
ggcacattgggtggggatttcctgtccagtcttccactacatgagtacccacctgccttc
cccctgggggccgatattcaaggtttagatttattttctttccttcagactgaaggtcag
cactatggtccctctgtcatcacctcgctagatgagcaggatgcccttggccacttcttc
cagtaccgagggaccccttcccacttcctgagcccactagcccccacactggggagctct
caccgcagcaccactccagcaccccctcctggccgtgtcagtagcattgtagcccctgga
ggtgccttgagggaggggcatggaggacccctacccttgggtccctctttgactgactgc
cggtcagacatcatttccctggactga

KEGG   Manis javanica (Malayan pangolin): 108406656
Entry
108406656         CDS       T06054                                 

Gene name
PIAS1
Definition
(RefSeq) E3 SUMO-protein ligase PIAS1
  KO
K04706  E3 SUMO-protein ligase PIAS1 [EC:2.3.2.-]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04120  Ubiquitin mediated proteolysis
mjv04630  JAK-STAT signaling pathway
mjv05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    108406656 (PIAS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108406656 (PIAS1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    108406656 (PIAS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mjv04121]
    108406656 (PIAS1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mjv04812]
    108406656 (PIAS1)
Enzymes [BR:mjv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     108406656 (PIAS1)
Ubiquitin system [BR:mjv04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   108406656 (PIAS1)
Cytoskeleton proteins [BR:mjv04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septin associated proteins
    108406656 (PIAS1)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse
Other DBs
NCBI-GeneID: 108406656
NCBI-ProteinID: XP_017530972
LinkDB
Position
Unknown
AA seq 496 aa
LASDNSQRFRETCFAFALTPQQVQQISSSMDISGTKCDFTVQVQLRFCLSETSCPQEDHF
PPNLCVKVNTKPCSLPGYLPPTKNGVEPKRPSRPINITSLVRLSTTVPNTIVVSWTAEIG
RNYSMAVYLVKQLSSTVLLQRLRAKGIRNPDHSRALIKEKLTADPDSEIATTSLRVSLLC
PLGKMRLTIPCRALTCSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFMEI
LKYCTDCDEIQFKEDGSWAPMRSKKEVQEVSASYNGVDGCLSSALEHQVASHHPSSNKNK
QVEVIDLTIDSSSDEEEEEPSAKRACPSLSPTSPLNNKGILSLPHQASPVSRTPSLPAVD
TSYVNTSLIQDYRHPFHMTPMPYDLQGLDFFPFLSGDNQHYNTSLLAAAAAAVSDDQDLL
HSSRFFPYTSSQMFLDQLSAGGSASLPTTNGSSSGSNSSLVSSNSLREGHAHAVASRGGA
DAASIFGIIPDIISLD
NT seq 1491 nt   +upstreamnt  +downstreamnt
ttagcatcagacaacagtcagcgctttcgagaaacctgttttgcatttgcattgacacca
caacaagtgcagcaaatcagtagttccatggatatttctgggaccaaatgtgacttcaca
gtgcaggtccagttaaggttttgtttatcagaaaccagttgtccacaagaagatcacttc
ccacccaatctttgtgtgaaagtgaatacaaaaccctgcagccttccaggttatcttcca
cctactaaaaatggtgtggaaccaaagcgacccagccgaccaattaatatcacatcactt
gtccgattgtccacaacagtaccaaacaccattgttgtttcttggactgcagaaatcgga
agaaactattccatggcagtgtatcttgtaaaacaattgtcctcaacagttcttcttcag
aggttacgagcaaagggaataaggaatccggatcattctagagctttaattaaagagaaa
ttgactgcggatccagacagtgaaatagctacaaccagcctaagggtttctctgctatgt
ccacttggtaaaatgcggctgacaattccgtgtcgggcccttacatgttcccatctgcag
tgttttgatgcaactctttatattcagatgaatgagaaaaaaccaacctgggtctgtcct
gtctgtgataagaaggctccgtatgaacaccttattattgatggcttatttatggaaatc
ctaaagtactgtacagattgtgatgaaatacagtttaaggaggatggctcttgggcacct
atgagatcgaagaaggaagtacaggaagtctctgcctcttacaatggagttgatggatgc
ttgagctctgcattggagcatcaggtggcctctcatcacccgtcctcaaataaaaataag
caagtagaggtgatcgacctgaccatagatagttcatccgatgaagaagaggaagagccg
tccgccaagagggcctgtccttccctgtcccccacgtcaccactgaataataaaggcata
ttaagtcttccacatcaagcatctccagtgtcccgcaccccaagcctccctgctgtagac
acgagctacgtcaacacatccctcatccaagactacaggcatccgttccacatgacaccc
atgccttacgacttacaaggattagatttctttcctttcttatcaggagacaatcagcat
tataacacctccctccttgccgccgcagcagccgccgtttcagatgatcaagacctctta
cactcgtctcggttttttccatatacctcctcacagatgtttcttgatcagttaagcgca
ggaggcagtgcctctctgccaaccaccaacgggagcagcagcggcagtaacagcagcctc
gtctcctccaacagcctgcgggagggccacgcgcacgccgtggcgagcagaggcggcgcg
gacgcggcgtccatcttcggcatcatccccgacatcatctcactggactga

KEGG   Manis javanica (Malayan pangolin): 108408312
Entry
108408312         CDS       T06054                                 

Gene name
PIAS4
Definition
(RefSeq) E3 SUMO-protein ligase PIAS4
  KO
K16065  E3 SUMO-protein ligase PIAS4 [EC:2.3.2.27]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04064  NF-kappa B signaling pathway
mjv04120  Ubiquitin mediated proteolysis
mjv04630  JAK-STAT signaling pathway
mjv05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    108408312 (PIAS4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108408312 (PIAS4)
   04064 NF-kappa B signaling pathway
    108408312 (PIAS4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108408312 (PIAS4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mjv04121]
    108408312 (PIAS4)
Enzymes [BR:mjv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     108408312 (PIAS4)
Ubiquitin system [BR:mjv04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   108408312 (PIAS4)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse Sporozoite_P67 SAP CENP-B_dimeris
Other DBs
NCBI-GeneID: 108408312
NCBI-ProteinID: XP_017533748
LinkDB
Position
Unknown
AA seq 503 aa
MVMSFRVSDLQMLLGFVGRSKSGLKHELVTRALQLVQFDCSPELFKKIKELYETRYAKKS
SEPVPQPHRPLDPLTMHSAYDRAGSVPRTPLTGPSIDYPTLYGKYLNGLGRLPAKTLQPE
VRLVKLPFFNMLDELLKPTELVPQNNEKLQESPCIFALTPRQVELIRNSRELQPGIKAVQ
VVLRICYSDTSGPQEDQYPPNIAVKVNHSYCSVPGYYPSNKPGVEPKRPCRPINLTHLMY
LSSATNRITVTWGNYGKSYSVALYLVRQLTSSELLQRLKTIGVKHPELCKALVKEKLRLD
PDSEIATTGVRVSLICPLVKMRLSVPCRAETCAHLQCFDAVFYLQMNEKKPTWMCPVCDK
PAPYDQLIIDGLLSKILSECEDADEIEYLVDGSWCPIRAEKEQSCSPQRPILVLGTSDTN
GLLSTPNVNGGGVGVLGGAGGGGGAGGGIENGKPGADVVDLTLDSSSSSEGEEDEDEDEE
DEDEEGPRPKRRCPFPKGLVSAC
NT seq 1512 nt   +upstreamnt  +downstreamnt
atggtgatgagcttccgagtctccgatcttcagatgctcttgggtttcgtcggccgaagt
aagagtggacttaaacacgaacttgtcacccgggccctccagctggtccagtttgactgc
agccctgagctattcaagaagatcaaggagctctacgagacacgctacgccaagaagagc
tcagagcccgtcccccagccccaccggcccctggaccccctgaccatgcactcagcctac
gatcgggccggctccgtgcccaggactcccctcacaggccccagcatcgactaccccacg
ctctatgggaagtacttaaatggacttgggcggctgcccgccaaaaccctccagccggag
gtgcgcctcgtgaagctgcccttctttaacatgctggatgagctgctgaagcccactgag
ctggttccacagaataacgagaagcttcaagagagcccatgcatcttcgccttgacaccg
aggcaggtggagctgatccggaactccagggaactgcagccggggatcaaggccgtgcag
gtcgtcctaagaatctgttactcggacaccagcggccctcaggaggaccagtaccctccc
aacattgccgtgaaggtcaaccacagctactgctcggtgccgggctactacccctcaaat
aagcccggagtggagcccaagaggccctgccgccccatcaacctcacccacctcatgtac
ctctcctcggccaccaaccgtatcaccgtcacctgggggaactatggcaagagttactct
gtggccttgtacttggtgcggcagctgacttcctcggagctgctgcagaggttgaaaacc
atcggcgtcaagcatccggagctgtgcaaggcgctggtcaaggagaagctgcgtctggac
cccgacagcgagattgccaccaccggcgtgcgggtctccctcatctgcccgctcgtgaag
atgcggctctcggtgccctgccgggcggagacctgcgcccacctgcagtgcttcgacgcc
gtcttctacctccagatgaatgagaagaagcccacctggatgtgccccgtttgcgacaag
ccggccccctacgaccagctcatcatcgatgggctcctctccaagatcctgagcgagtgc
gaggacgccgacgagatcgagtacctggtggacggctcgtggtgcccaatccgcgccgag
aaggagcaaagctgcagcccccagcgcccgatcctggtgcttgggacctcggacaccaat
gggctcctgtccacccctaatgtcaacggcggtggcgtcggcgtgcttgggggtgccggt
ggcgggggcggcgctgggggcggcattgagaatgggaagccaggagccgacgtggtggac
ctcacgctggacagctcgtcgtcctcggagggggaggaggacgaagacgaggacgaggag
gacgaggacgaggagggcccccggcccaaacgccgctgccccttcccgaagggcctggtg
tcggcctgctga

DBGET integrated database retrieval system