KEGG   Manis javanica (Malayan pangolin): 108400819
Entry
108400819         CDS       T06054                                 

Gene name
IKBKG
Definition
(RefSeq) NF-kappa-B essential modulator isoform X1
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01523  Antifolate resistance
mjv04010  MAPK signaling pathway
mjv04014  Ras signaling pathway
mjv04062  Chemokine signaling pathway
mjv04064  NF-kappa B signaling pathway
mjv04151  PI3K-Akt signaling pathway
mjv04210  Apoptosis
mjv04380  Osteoclast differentiation
mjv04620  Toll-like receptor signaling pathway
mjv04621  NOD-like receptor signaling pathway
mjv04622  RIG-I-like receptor signaling pathway
mjv04623  Cytosolic DNA-sensing pathway
mjv04625  C-type lectin receptor signaling pathway
mjv04657  IL-17 signaling pathway
mjv04658  Th1 and Th2 cell differentiation
mjv04659  Th17 cell differentiation
mjv04660  T cell receptor signaling pathway
mjv04662  B cell receptor signaling pathway
mjv04668  TNF signaling pathway
mjv04920  Adipocytokine signaling pathway
mjv05132  Salmonella infection
mjv05135  Yersinia infection
mjv05142  Chagas disease
mjv05145  Toxoplasmosis
mjv05160  Hepatitis C
mjv05161  Hepatitis B
mjv05162  Measles
mjv05163  Human cytomegalovirus infection
mjv05164  Influenza A
mjv05165  Human papillomavirus infection
mjv05166  Human T-cell leukemia virus 1 infection
mjv05167  Kaposi sarcoma-associated herpesvirus infection
mjv05168  Herpes simplex virus 1 infection
mjv05169  Epstein-Barr virus infection
mjv05170  Human immunodeficiency virus 1 infection
mjv05200  Pathways in cancer
mjv05203  Viral carcinogenesis
mjv05212  Pancreatic cancer
mjv05215  Prostate cancer
mjv05220  Chronic myeloid leukemia
mjv05221  Acute myeloid leukemia
mjv05222  Small cell lung cancer
mjv05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mjv05340  Primary immunodeficiency
mjv05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108400819 (IKBKG)
   04014 Ras signaling pathway
    108400819 (IKBKG)
   04064 NF-kappa B signaling pathway
    108400819 (IKBKG)
   04668 TNF signaling pathway
    108400819 (IKBKG)
   04151 PI3K-Akt signaling pathway
    108400819 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108400819 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108400819 (IKBKG)
   04621 NOD-like receptor signaling pathway
    108400819 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    108400819 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    108400819 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    108400819 (IKBKG)
   04660 T cell receptor signaling pathway
    108400819 (IKBKG)
   04658 Th1 and Th2 cell differentiation
    108400819 (IKBKG)
   04659 Th17 cell differentiation
    108400819 (IKBKG)
   04657 IL-17 signaling pathway
    108400819 (IKBKG)
   04662 B cell receptor signaling pathway
    108400819 (IKBKG)
   04062 Chemokine signaling pathway
    108400819 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    108400819 (IKBKG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108400819 (IKBKG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108400819 (IKBKG)
   05203 Viral carcinogenesis
    108400819 (IKBKG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108400819 (IKBKG)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    108400819 (IKBKG)
   05221 Acute myeloid leukemia
    108400819 (IKBKG)
   05220 Chronic myeloid leukemia
    108400819 (IKBKG)
   05215 Prostate cancer
    108400819 (IKBKG)
   05222 Small cell lung cancer
    108400819 (IKBKG)
  09163 Immune disease
   05340 Primary immunodeficiency
    108400819 (IKBKG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108400819 (IKBKG)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108400819 (IKBKG)
   05135 Yersinia infection
    108400819 (IKBKG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108400819 (IKBKG)
   05170 Human immunodeficiency virus 1 infection
    108400819 (IKBKG)
   05162 Measles
    108400819 (IKBKG)
   05164 Influenza A
    108400819 (IKBKG)
   05161 Hepatitis B
    108400819 (IKBKG)
   05160 Hepatitis C
    108400819 (IKBKG)
   05168 Herpes simplex virus 1 infection
    108400819 (IKBKG)
   05163 Human cytomegalovirus infection
    108400819 (IKBKG)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108400819 (IKBKG)
   05169 Epstein-Barr virus infection
    108400819 (IKBKG)
   05165 Human papillomavirus infection
    108400819 (IKBKG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108400819 (IKBKG)
   05142 Chagas disease
    108400819 (IKBKG)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    108400819 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mjv01001]
    108400819 (IKBKG)
Protein kinases [BR:mjv01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   108400819 (IKBKG)
SSDB
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10
Other DBs
NCBI-GeneID: 108400819
NCBI-ProteinID: XP_017521897
LinkDB
Position
Unknown
AA seq 419 aa
MSRHPWKSQLCDMVQPSSGPAGDQDVLGEESSLGKPAMLHLPSEQSTSETFQRCLEENQE
LRDAIQQSNQMLREHCEELQRFQGSQREEKEFLMQKFQEAKKLVERLSLEKLDLRRQREQ
ALQEMEHLKRCQQQMVEDKASVKAQVTSLLGELQESQSRLEAATKERQALEGRARAAGEQ
ARQLASEREALQRQHSVQVDQLRMQNQSVEAALRVERQAASEEKRKLAQLQVAYHQLFQE
YDNHVKSSMASSERNRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKTVMETIPV
LKAQADIYKADFQAERQAREKLAEKKEVLQEQFEQLQREYSRLKASCQESARIEDMRKRH
VEVAQAPLALAPASHSFHPALPSQRRSAPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgagtaggcacccctggaagagtcagctgtgtgacatggtgcagcctagcagtggccca
gcaggggaccaggacgtgctgggcgaagagtcctctctggggaagccggccatgctgcac
ttgccttcagagcagagcacttctgagacgttccagcggtgtctggaggagaatcaagag
ctccgagatgccatccagcaaagcaaccagatgctgcgggagcactgtgaggagctgcag
cgtttccaaggcagccagcgggaggagaaagagttccttatgcagaaattccaggaagca
aagaaactggtggagagactgagcctggagaagctcgacctgaggagacagagggagcag
gccctgcaggagatggagcacctgaagagatgccagcagcagatggttgaagacaaggcc
tcggtgaaagcccaggtgacgtccttgctgggggagctgcaggagagccagagtcgtttg
gaggctgccaccaaggagcggcaggccttggagggcagggcccgcgcggctggtgagcag
gcccggcagctggccagtgagcgggaggcactgcagcggcagcacagcgtgcaggtggac
cagctgcgcatgcagaaccagagcgtggaggctgccctgcgcgttgaacgccaggctgcc
tctgaggagaagcggaagctggcccagctacaggtggcctatcaccagctcttccaagag
tatgacaaccacgtcaagagcagcatggcgagcagtgagcggaaccgaggaatgcagctg
gaagatctcaagcagcagctccagcaggctgaggaggccctggtggccaaacaggaagtg
atcgacaagctcaaggaagaggccgagcagcacaagactgtgatggagaccatcccagtg
cttaaggcccaggcggatatctataaggcagacttccaggctgagaggcaggcccgggag
aagctggctgagaagaaggaagtcctgcaggagcagtttgagcagctgcagagggagtac
agcaggttgaaggccagctgtcaggagtcggccaggattgaagatatgaggaagcggcat
gtagaggttgcccaggcccccttagccctggccccagcttcccactccttccacccggcc
ctgcccagccagaggagaagtgcccctgaggagccacccgacttctgttgccccaagtgc
cagtatcaggctcctgatatggataccctgcagatacacgtcatggaatgcatcgagtag

DBGET integrated database retrieval system