KEGG   Manis javanica (Malayan pangolin): 108401094
Entry
108401094         CDS       T06054                                 

Gene name
MAP3K5
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 5
  KO
K04426  mitogen-activated protein kinase kinase kinase 5 [EC:2.7.11.25]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01524  Platinum drug resistance
mjv04010  MAPK signaling pathway
mjv04071  Sphingolipid signaling pathway
mjv04141  Protein processing in endoplasmic reticulum
mjv04210  Apoptosis
mjv04530  Tight junction
mjv04668  TNF signaling pathway
mjv04714  Thermogenesis
mjv04722  Neurotrophin signaling pathway
mjv04932  Non-alcoholic fatty liver disease
mjv05010  Alzheimer disease
mjv05012  Parkinson disease
mjv05014  Amyotrophic lateral sclerosis
mjv05016  Huntington disease
mjv05017  Spinocerebellar ataxia
mjv05022  Pathways of neurodegeneration - multiple diseases
mjv05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    108401094 (MAP3K5)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108401094 (MAP3K5)
   04668 TNF signaling pathway
    108401094 (MAP3K5)
   04071 Sphingolipid signaling pathway
    108401094 (MAP3K5)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108401094 (MAP3K5)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    108401094 (MAP3K5)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    108401094 (MAP3K5)
  09159 Environmental adaptation
   04714 Thermogenesis
    108401094 (MAP3K5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108401094 (MAP3K5)
   05012 Parkinson disease
    108401094 (MAP3K5)
   05014 Amyotrophic lateral sclerosis
    108401094 (MAP3K5)
   05016 Huntington disease
    108401094 (MAP3K5)
   05017 Spinocerebellar ataxia
    108401094 (MAP3K5)
   05022 Pathways of neurodegeneration - multiple diseases
    108401094 (MAP3K5)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108401094 (MAP3K5)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    108401094 (MAP3K5)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108401094 (MAP3K5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mjv01001]
    108401094 (MAP3K5)
Enzymes [BR:mjv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     108401094 (MAP3K5)
Protein kinases [BR:mjv01001]
 Serine/threonine kinases: STE group
  STE11 family
   108401094 (MAP3K5)
SSDB
Motif
Pfam: DUF4071 Pkinase ASK_PH PK_Tyr_Ser-Thr FPP Pkinase_fungal Kinase-like
Other DBs
NCBI-GeneID: 108401094
NCBI-ProteinID: XP_017522321
LinkDB
Position
Unknown
AA seq 1577 aa
MVSLGRTEADSSWGKLVILTTGKIPRHSEILAAPYFARPKRLSAAPDPSPLRHAGLRALR
LSSVARRASPRPEGGAAAAGNAAKVSRTSSIDQSIRKRDFFLVCPVVALRSERLLTSGLL
GGGPGWRRRSTWPHAEVRELPRGRYRPGPGFPAAPSPGAGPDSRCRDEWAARNRWHAGRA
AARNGDFSGEAGSGRGGRGDRKRNGAGEEEEIEPMKGSCRRGGRRILSAAAAAFPGRSPG
SRPACEVLASPPPPGSLWNLESAAAPGAGLPAASSGSSATRCRGISGGGGGRRTTVAYVI
NEESQGQLVMAESEALQSLREACETVGAALETLHFGKLDFGETAVLDRFYNADIAVVEMS
DAFRQPSLFYHLGVRESFSMANNIILYCDNNSDSLQSLKEIICQKNTMCTGNYTFVPYMI
TPHNKVYCCDSSFMKGLTELMQPNFELLLGPICLPLVDRFIQLLKVAQASSSQYFRESIL
NDIRKARNLYTGKELAAELARIRQRVDNTEVLTADIVINLLLSYRDIQDYDSIVKLVETL
EKLPTFDLASHHHVKFHYAFALNRRNLPGDRSKALDVMIPLVQSEEQVASDMYCLVGRIY
KDMFLDSNFMDTESRDHGASWFKKAFESEPSLQSGINYAVLLLAAGHQFESSFELRKVGV
KLSSLLGKKGNLEKLQSYWEVGFFLGASVLANDHMRVIQASEKLFKLKTPAWYLKSIVET
ILIYKHFVKLTTEQPVAKQELVDFWMDFLVEATKTDVTVVRFPVLILEPTKIYQPSYLSI
NNEVEEKTISIWHVLPDDKKGIHEWNFSASSIRGVSISKFEERCCFLYVLHNSDDFQIYF
CTELHCKKFFEMVNTITEEKGRSTEEGDCEGDSLEYDYEYDENGDRVVLGKGTYGIVYAG
RDLSNQVRIAIKEIPERDSRYSQPLHEEIALHKHLKHRNIVQYLGSFSENGFIKIFMEQV
PGGSLSALLRSKWGPLKDNEQTIGFYTKQILEGLKYLHDNQIVHRDIKGDNVLINTYSGV
LKISDFGTSKRLAGINPCTETFTGTLQYMAPEIIDKGPRGYGKAADIWSLGCTIIEMATG
KPPFYELGEPQAAMFKVGMFKVHPEIPESMSEEAKAFILKCFEPDPDKRACANDLLIDEF
LKVSSKKKKTQPKLSALSAGSNEYLRSISLPVPVLVEDASSSSEYGSVSPDTELKVDPFN
FKTRAKSCGEKDVKGIRTLFLGIPDENFEDHSAPPSPEEKDSGFFMLRKDSERRATLHRI
LTEDQDKVVRNLMETLAQGAEEPKLKWEHITTLIASLREFVRSTDRKIIATTLSKLKLEL
DFDSHGISQVQMVLFSFQDAVNKVLRNHNIKPHWMFALDSIIRKAVQTAITILVPELRPH
FSLASESDTADQEDLDAEDDHEEHPSNQTVRRPPAVIEDAVATSGVSTLSSTVSHDSQSA
HRSLNVQLGRMKIETNRLLEELIQKEKELQAFLHQAIEEKEQEIKNLKLKSQPIDIPGLP
VCHLSSPDTNTEGSELTDWLRENGADEDTISQFLAEDYSLVDVLYYVTRDDLKCLRLRGG
MLCTLWKAITDFRDKQT
NT seq 4734 nt   +upstreamnt  +downstreamnt
atggtctctctgggaaggacagaggctgattccagctggggtaaactggtgatcctgacc
acgggaaaaattccaaggcattctgagatattagctgctccttactttgcaaggcccaag
cgcctcagcgctgctccagatccttcccccttgcgccacgcgggcctccgggcgctgcgt
ctttccagcgtcgcacgccgtgccagcccgaggccggaagggggcgccgcggccgcgggg
aacgccgcgaaggtctcgcggaccagctccatagaccagagtattcgcaagagagacttt
tttttggtctgtcctgtcgtcgcgttgcgctccgagcgtttgcttacttcaggtcttctt
ggtggggggcctggttggcggcggcggagcacttggccccacgctgaggtccgggagctg
ccgcgcggtcggtaccgtcccggcccgggcttcccagcagcgccctcccccggggcgggc
cctgactctcggtgccgcgacgagtgggcggcaagaaaccggtggcacgccgggcgagcg
gctgcgagaaacggcgactttagcggcgaggctggctctggacgaggcggccgcggcgat
cggaagagaaacggggccggggaggaggaggaaatagagccgatgaaggggagctgccgc
cgaggagggaggaggatcctttcggctgcagcggccgcctttccgggacgcagcccgggg
agtcggcctgcctgtgaggtgctcgccagcccgccgccgccgggcagcttgtggaacctg
gagagtgccgccgctcctggcgccgggttaccagctgcctcctccgggagcagcgccacc
cggtgccggggcatctccgggggcggaggcggccgacgcaccacggtggcttacgtgatt
aacgaagagagccaagggcagctggtgatggccgagagcgaggctctgcagagcctgcgg
gaggcgtgcgagacggtgggcgccgccttggagaccctgcattttggtaaactggacttc
ggggaaaccgcggtgctggaccgtttttacaatgcagatattgctgtggtggagatgagt
gatgccttcaggcagccttctttgttttaccacctgggagtgagagaaagtttcagcatg
gccaataacatcatcctctactgtgacaataattcagactctcttcagtcgctgaaggaa
atcatttgccagaagaatactatgtgcactgggaactacacgtttgttccttacatgata
actccacacaacaaggtctactgctgtgacagcagcttcatgaaggggttgacagagctc
atgcaaccaaacttcgagctgctgctcggacccatctgcttaccacttgtggaccgtttc
attcagcttctgaaggtggcacaagcaagttccagccagtatttccgggaatctatactc
aatgatatccggaaagctcgtaatttatacactggtaaagaactggcagctgaattggca
agaattcgacagcgagtggacaatactgaagtcttgacagcagatattgtcataaatctg
ttactttcctacagagatatccaggactatgattctattgtgaagctggtagagacttta
gaaaaactgccaacctttgatttggcctctcatcaccatgtgaagtttcattatgcattt
gcactgaacaggagaaatctccctggagataggtcaaaagctcttgatgttatgattcct
ctggtgcaaagtgaagagcaagttgcttcagatatgtactgcttagttggtcgaatctac
aaagatatgtttttggactctaatttcatggacactgaaagtagagaccatggagcttct
tggttcaaaaaggcatttgaatctgagccatcactacagtcaggaattaattatgccgtc
ctccttctggcagctgggcaccagtttgagtcttcctttgagctccggaaagttggggtg
aagctaagtagccttcttggtaaaaagggaaacttagaaaaactccagagctactgggaa
gttggattttttctgggagccagtgtgttggccaatgaccacatgagagttattcaagca
tctgaaaagctttttaaactgaagacaccagcatggtacctcaagtcaattgtagagaca
attttgatatataagcattttgtgaaactgactacagaacagcctgtggccaagcaggaa
cttgtggacttctggatggatttcctggtggaggccacaaagacagatgttactgtagtt
aggtttcctgtattaatattagaaccaaccaaaatctatcaaccttcttatttatctatc
aacaatgaagttgaggagaagacaatatctatttggcacgtgcttcctgatgacaagaaa
ggtatacatgaatggaattttagtgcttcttccatcaggggagtgagtatttctaaattt
gaagaacgatgctgttttctttatgtgcttcataattctgacgatttccagatctatttc
tgtacagaacttcattgcaaaaagttttttgaaatggtgaacaccattactgaagagaag
gggagaagtacagaggaaggagattgtgaaggtgactccctggagtatgactatgaatat
gatgaaaatggtgacagagtcgttttaggaaaaggcacttatgggatagtctatgcaggt
cgggacctgagcaaccaggtcagaattgctatcaaagaaatcccagagagagacagcagg
tactcccagcccctacatgaagaaatagcactgcataagcatctgaagcacagaaatatt
gtccagtatctgggctcttttagtgagaatggtttcattaaaatcttcatggagcaggtc
ccaggaggaagtctttctgctctccttcgttccaaatggggcccactgaaagacaatgag
caaaccattggcttttatacaaagcaaatacttgaaggattaaaatacctccatgacaat
cagatagttcaccgagatataaagggtgacaatgtgttgataaatacctatagtggtgtt
ctcaagatctctgacttcggaacatcaaagagattggctggcataaatccatgtaccgaa
acatttactggtacccttcaatatatggcaccagaaataatcgataaaggaccaagaggc
tacggaaaagcagcggacatttggtctttgggctgcacaatcattgaaatggccacaggg
aaaccacccttttatgaactgggagaaccacaagcagctatgttcaaggtgggaatgttt
aaagtccacccggagatcccagagtccatgtcggaagaggccaaggcattcatactgaaa
tgttttgaaccagatcctgacaagagagcctgtgctaatgacttgcttattgatgagttc
ctaaaggtttcaagcaaaaagaaaaagacacaacctaagctttcagctctctcagctgga
tcaaatgagtatctgaggagcatatccttgcccgtgccggtcctggtggaggatgccagc
agcagcagcgagtatggctcagtctcccccgacacggagctaaaagtggacccattcaat
ttcaaaacaagagccaaatcctgcggagaaaaagacgtaaaaggaatacggacgctcttt
ttgggcattccagatgaaaattttgaagatcatagtgctccaccttccccggaagagaaa
gactctggattctttatgctaaggaaggacagtgaaagacgggccacccttcacaggatc
ctgacggaagaccaagacaaggtcgtgagaaacctaatggaaactttggctcagggggct
gaagaacctaaactaaaatgggagcacatcacaaccctcatcgcaagcctcagagaattt
gtgagatccactgatcgaaaaatcattgccacaacactgtcaaagctgaagttagagctt
gactttgacagccatggcattagtcaagtccaaatggtgctctttagttttcaagatgct
gtcaataaagttcttcggaatcataacatcaagccacactggatgtttgccttagacagt
atcatccgaaaggcagtgcagacagccattaccattctggttccagaactgaggccgcac
ttcagccttgcatctgagagtgatactgctgatcaagaagacttggatgcagaagacgac
catgaggaacacccttcaaaccaaactgtccgaagacctcctgctgtcattgaagatgct
gtggctacctcaggggtgagcacgctcagttccacggtatcccacgattcccagagcgct
caccgatccctgaatgtacagcttggaaggatgaaaatagaaactaatagattgttggaa
gaattgattcagaaagagaaagaattacaagcttttctccatcaagctattgaagaaaaa
gaacaagaaattaaaaacctgaagcttaagtcccaaccaatagatatccccggactgcct
gtgtgtcacctcagttctcctgacacaaacacggaaggttccgaacttactgactggctg
agagaaaatggagctgatgaagacactataagtcagtttctggctgaggattattcacta
gtggatgttctctactatgttacacgtgatgatttaaaatgcctgagactaaggggaggg
atgctatgcacactgtggaaggccatcactgactttcgagacaaacaaacttga

DBGET integrated database retrieval system