KEGG   Manis javanica (Malayan pangolin): 108401404
Entry
108401404         CDS       T06054                                 

Gene name
PTGDR
Definition
(RefSeq) prostaglandin D2 receptor
  KO
K04332  prostaglandin D2 receptor
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    108401404 (PTGDR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mjv04030]
    108401404 (PTGDR)
G protein-coupled receptors [BR:mjv04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    108401404 (PTGDR)
SSDB
Motif
Pfam: 7tm_1 PhoR
Other DBs
NCBI-GeneID: 108401404
NCBI-ProteinID: XP_017522810
LinkDB
Position
Unknown
AA seq 358 aa
MRPSFYRCHNATSVEKGNSATMSGLLFSAGLLGNLMALALLARSGLGSCPPRQPPSVFYV
LVCGLTVTDLVGKSLVSPFVLAAYAQNRSLSGLVPASGRSLCQAFAFFMSFFGLASTLQL
LAMALECWLSLGHPFFYRRHVTVRRGALVAPVVGAFCLAFCALPFAGFGNFVQYCPGTWC
FIQMTHKERSLSVLGFSVLYASLMALLVLAIVLCNLSAMRNLYAMHRRLQRIPRFGPRER
AEPGAGEREASPQPLEELDHLLLLALMTGLFTMCSLPLIYRAYDGAFKAVPEKNGASEET
KDLQALRFLSVISIVDPWIFIIFRTSVFRMFFHKIFIRPLMYRNWHNNSCQTNMESSL
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgaggccgtcgttctaccgctgccacaacgccacctctgtggagaagggcaactccgcg
acgatgagcgggctgctcttcagtgcgggcctcctgggcaacctgatggccctggcgctg
ctggcgcgctcggggctggggtcgtgcccaccgcgccagcccccctcggtcttttacgtg
ctggtgtgcggcctgacggtcaccgacttggtgggcaagtcgctggtgagccccttcgtg
ctagccgcctacgcgcagaaccggagcctgtcggggctggtacccgcgtcgggccgctcg
ctgtgccaagccttcgccttcttcatgtccttcttcgggctcgcttcgacgctgcagctc
ctggccatggctctggagtgctggctgtcgttggggcatcccttcttctaccgacggcac
gtcacggtgcgccggggcgcgctggtggcgcctgtcgtgggcgccttctgcctggctttc
tgcgccttgcccttcgcgggcttcgggaatttcgtgcagtactgccccggcacctggtgc
ttcatccaaatgacccacaaggagcgctcgctgtcagtgctgggcttctcagtgctctac
gccagcctcatggcgctgctggtcctcgccatcgtgctgtgcaacctgagcgccatgcgc
aacctctacgcgatgcaccggcggctgcagcggatcccgcgcttcggccccagagagcgc
gcggagccgggcgccggcgagagggaggcctccccgcagcccctggaggagctggatcac
ctcctgctgctggccctcatgaccgggctcttcaccatgtgctccctgcctttaatctac
cgtgcttatgatggagcctttaaagctgttcctgagaaaaacggagcctctgaagaaaca
aaagacctccaagccttgcgttttctatctgtgatctcaattgtggacccttggattttc
atcattttcagaacatcagtatttcgcatgttttttcacaagattttcataaggcctctt
atgtatagaaattggcacaacaattcctgccaaactaacatggaatccagtctgtga

DBGET integrated database retrieval system