KEGG   Manis javanica (Malayan pangolin): 108401442
Entry
108401442         CDS       T06054                                 

Definition
(RefSeq) FAS-associated death domain protein-like
  KO
K02373  FAS-associated death domain protein
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01524  Platinum drug resistance
mjv04210  Apoptosis
mjv04215  Apoptosis - multiple species
mjv04217  Necroptosis
mjv04620  Toll-like receptor signaling pathway
mjv04621  NOD-like receptor signaling pathway
mjv04622  RIG-I-like receptor signaling pathway
mjv04657  IL-17 signaling pathway
mjv04668  TNF signaling pathway
mjv05010  Alzheimer disease
mjv05022  Pathways of neurodegeneration - multiple diseases
mjv05132  Salmonella infection
mjv05142  Chagas disease
mjv05152  Tuberculosis
mjv05160  Hepatitis C
mjv05161  Hepatitis B
mjv05162  Measles
mjv05163  Human cytomegalovirus infection
mjv05164  Influenza A
mjv05165  Human papillomavirus infection
mjv05167  Kaposi sarcoma-associated herpesvirus infection
mjv05168  Herpes simplex virus 1 infection
mjv05169  Epstein-Barr virus infection
mjv05170  Human immunodeficiency virus 1 infection
mjv05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    108401442
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108401442
   04215 Apoptosis - multiple species
    108401442
   04217 Necroptosis
    108401442
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108401442
   04621 NOD-like receptor signaling pathway
    108401442
   04622 RIG-I-like receptor signaling pathway
    108401442
   04657 IL-17 signaling pathway
    108401442
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108401442
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108401442
   05022 Pathways of neurodegeneration - multiple diseases
    108401442
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108401442
   05152 Tuberculosis
    108401442
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108401442
   05161 Hepatitis B
    108401442
   05160 Hepatitis C
    108401442
   05164 Influenza A
    108401442
   05162 Measles
    108401442
   05168 Herpes simplex virus 1 infection
    108401442
   05163 Human cytomegalovirus infection
    108401442
   05167 Kaposi sarcoma-associated herpesvirus infection
    108401442
   05169 Epstein-Barr virus infection
    108401442
   05165 Human papillomavirus infection
    108401442
  09174 Infectious disease: parasitic
   05142 Chagas disease
    108401442
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108401442
SSDB
Motif
Pfam: Death tRNA_NucTran2_2 DUF3584 ZapA
Other DBs
NCBI-GeneID: 108401442
NCBI-ProteinID: XP_017522868
LinkDB
Position
Unknown
AA seq 194 aa
GGQRRFVPLSPPGAASLPGVLCVGLHHARRDTGPAHAQVREPGLERLAWVAKHGPAAATP
GFPSVTPLLQLNEKFLGRKGRCRPPWVGKAGQELDLRAAFDIICDNVGKDWRRLARQLKV
SDAKIDAIEEKYPRNLTEQVRESLRVWKNAGKEDAAVSHLVAALRACRLNLVADLIEEDQ
QARDLQNQDLAPCP
NT seq 585 nt   +upstreamnt  +downstreamnt
ggggggcagcggcggtttgtcccgctgagcccgccgggcgccgcgtctttgccgggcgtg
ctttgcgtgggtttgcaccacgcgcgccgggacacggggcctgcccacgcgcaggtgcga
gaacccggactggagaggttggcttgggtggcaaagcacggacccgccgccgccaccccc
ggatttccctctgtcaccccgttgctccagctaaacgagaaattcctcggaaggaaaggg
cgttgccgccctccttgggtggggaaagcggggcaggagttagatctgcgtgcggctttt
gacatcatatgtgataacgtggggaaggactggagaagactggctcgccagctcaaagtg
tccgatgccaagatcgatgccatcgaggagaaatacccccgcaacctgacggagcaggtg
agggagtctctgagagtctggaagaacgctgggaaagaggacgctgccgtgtcccacctg
gtggcggcactcagggcctgccggctgaatctggtggcagacctcatcgaggaggaccag
caggcccgggacctccagaaccaggacctggcgccatgtccctga

DBGET integrated database retrieval system