KEGG   Manis javanica (Malayan pangolin): 108401592
Entry
108401592         CDS       T06054                                 

Gene name
SRC
Definition
(RefSeq) proto-oncogene tyrosine-protein kinase Src isoform X1
  KO
K05704  tyrosine-protein kinase Src [EC:2.7.10.2]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01521  EGFR tyrosine kinase inhibitor resistance
mjv01522  Endocrine resistance
mjv04012  ErbB signaling pathway
mjv04015  Rap1 signaling pathway
mjv04062  Chemokine signaling pathway
mjv04137  Mitophagy - animal
mjv04144  Endocytosis
mjv04360  Axon guidance
mjv04370  VEGF signaling pathway
mjv04510  Focal adhesion
mjv04520  Adherens junction
mjv04530  Tight junction
mjv04540  Gap junction
mjv04611  Platelet activation
mjv04613  Neutrophil extracellular trap formation
mjv04625  C-type lectin receptor signaling pathway
mjv04727  GABAergic synapse
mjv04750  Inflammatory mediator regulation of TRP channels
mjv04810  Regulation of actin cytoskeleton
mjv04912  GnRH signaling pathway
mjv04915  Estrogen signaling pathway
mjv04917  Prolactin signaling pathway
mjv04919  Thyroid hormone signaling pathway
mjv04921  Oxytocin signaling pathway
mjv04926  Relaxin signaling pathway
mjv05100  Bacterial invasion of epithelial cells
mjv05135  Yersinia infection
mjv05152  Tuberculosis
mjv05161  Hepatitis B
mjv05163  Human cytomegalovirus infection
mjv05167  Kaposi sarcoma-associated herpesvirus infection
mjv05168  Herpes simplex virus 1 infection
mjv05203  Viral carcinogenesis
mjv05205  Proteoglycans in cancer
mjv05219  Bladder cancer
mjv05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    108401592 (SRC)
   04015 Rap1 signaling pathway
    108401592 (SRC)
   04370 VEGF signaling pathway
    108401592 (SRC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    108401592 (SRC)
   04137 Mitophagy - animal
    108401592 (SRC)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108401592 (SRC)
   04520 Adherens junction
    108401592 (SRC)
   04530 Tight junction
    108401592 (SRC)
   04540 Gap junction
    108401592 (SRC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108401592 (SRC)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    108401592 (SRC)
   04613 Neutrophil extracellular trap formation
    108401592 (SRC)
   04625 C-type lectin receptor signaling pathway
    108401592 (SRC)
   04062 Chemokine signaling pathway
    108401592 (SRC)
  09152 Endocrine system
   04912 GnRH signaling pathway
    108401592 (SRC)
   04915 Estrogen signaling pathway
    108401592 (SRC)
   04917 Prolactin signaling pathway
    108401592 (SRC)
   04921 Oxytocin signaling pathway
    108401592 (SRC)
   04926 Relaxin signaling pathway
    108401592 (SRC)
   04919 Thyroid hormone signaling pathway
    108401592 (SRC)
  09156 Nervous system
   04727 GABAergic synapse
    108401592 (SRC)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    108401592 (SRC)
  09158 Development and regeneration
   04360 Axon guidance
    108401592 (SRC)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    108401592 (SRC)
   05203 Viral carcinogenesis
    108401592 (SRC)
  09162 Cancer: specific types
   05219 Bladder cancer
    108401592 (SRC)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108401592 (SRC)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    108401592 (SRC)
   05152 Tuberculosis
    108401592 (SRC)
   05100 Bacterial invasion of epithelial cells
    108401592 (SRC)
  09172 Infectious disease: viral
   05161 Hepatitis B
    108401592 (SRC)
   05168 Herpes simplex virus 1 infection
    108401592 (SRC)
   05163 Human cytomegalovirus infection
    108401592 (SRC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108401592 (SRC)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108401592 (SRC)
   01522 Endocrine resistance
    108401592 (SRC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mjv01001]
    108401592 (SRC)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mjv04131]
    108401592 (SRC)
Enzymes [BR:mjv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     108401592 (SRC)
Protein kinases [BR:mjv01001]
 Non-receptor tyrosine kinases
  SRC family
   108401592 (SRC)
Membrane trafficking [BR:mjv04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    108401592 (SRC)
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    108401592 (SRC)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    108401592 (SRC)
  Macropinocytosis
   Kinases
    108401592 (SRC)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_9 SH3_2
Other DBs
NCBI-GeneID: 108401592
NCBI-ProteinID: XP_017523109
LinkDB
Position
Unknown
AA seq 553 aa
MGSNKSKPKDASQRRRSLEPAENAHGGGGGAFPTSQTPNKPASADGHRGPNTAFAPTAAE
PKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTRKV
DVSQTWFTFRWLQREGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESER
LLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQF
NSLQQLVAYYSKHADGLCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGE
VWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEY
MSKGSLLDFLKGETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVC
KVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGR
VPYPGMVNREVLDQVERGYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYF
TSTEPQYQPGENL
NT seq 1662 nt   +upstreamnt  +downstreamnt
atgggcagcaataagagcaagcccaaagatgccagccagcggcgccgcagcctggagccc
gccgagaacgcccatggtggtggtggtggggccttccccacctcacagacccccaacaag
ccggcctccgctgatggccaccgcggccccaacacagcctttgcccccactgctgccgag
cccaagctgtttggaggcttcaactcctcggacacagtcacctccccgcagagagcgggg
cccctggctggtggagtgaccacctttgtggccctctatgactatgagtcacggacagag
actgacctgtccttcaagaaaggggagcggctccagatcgtcaacaacacgaggaaggtg
gatgtcagccagacctggttcacattcagatggctgcaaagagagggagactggtggctg
gcccactcgctcagcaccggacagacaggctacatccccagcaactatgtggcaccctcc
gactccatccaggctgaggagtggtactttggcaagatcaccagacgggagtcagagcgg
ttactgctcaatgcggagaacccaagagggactttcctagtgcgagaaagcgagaccacg
aaaggtgcctactgcctctcggtgtctgatttcgacaacgccaagggcctcaatgtgaag
cactacaagatccgaaagctggacagtggtggcttctacatcacctctcgcacgcagttc
aacagtctgcagcagctagtggcctactactccaaacacgcagatggcctgtgccaccgc
ctcaccaccgtgtgccccacctccaagccacagactcagggcctggccaaggacgcctgg
gagatcccccgggagtccctgcggttggaggtcaagctgggccagggctgttttggagaa
gtctggatgggcacctggaatggcaccaccagggtggccatcaaaaccctgaagccaggc
acgatgtctccagaggccttcctgcaggaggcccaggtcatgaagaagctgaggcatgag
aagctggtgcagctgtacgcggtggtgtcggaggagcccatctacattgtcacagagtac
atgagcaaggggagtttgctggactttctcaagggggagacgggcaagtacctgcggctg
cctcagctggtggacatggctgctcagattgcttcaggcatggcgtatgtggagcggatg
aactacgttcaccgggacctccgtgctgccaacatccttgttggagagaaccttgtgtgc
aaagtagctgacttcgggctggctcggctcattgaagacaacgagtacacagcccgtcaa
ggtgccaagttccccatcaaatggacggctccagaagctgccctctatggccggttcacc
atcaagtcagatgtgtggtcctttgggatcctgctgacagagctcacgacaaaaggacgt
gtgccctaccctgggatggtgaaccgtgaggtgctggaccaggtggagcggggctaccgg
atgccctgtccgcctgaatgtcctgagtccctgcacgatctcatgtgccagtgctggcgg
aaggagcctgaggagcggcccacctttgagtacctgcaggccttcctggaggactacttt
acgtccaccgagccccagtaccagcccggagagaacctctag

DBGET integrated database retrieval system