KEGG   Manis javanica (Malayan pangolin): 108402534
Entry
108402534         CDS       T06054                                 

Gene name
FOS
Definition
(RefSeq) proto-oncogene c-Fos
  KO
K04379  proto-oncogene protein c-fos
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01522  Endocrine resistance
mjv04010  MAPK signaling pathway
mjv04024  cAMP signaling pathway
mjv04210  Apoptosis
mjv04380  Osteoclast differentiation
mjv04620  Toll-like receptor signaling pathway
mjv04657  IL-17 signaling pathway
mjv04658  Th1 and Th2 cell differentiation
mjv04659  Th17 cell differentiation
mjv04660  T cell receptor signaling pathway
mjv04662  B cell receptor signaling pathway
mjv04668  TNF signaling pathway
mjv04713  Circadian entrainment
mjv04725  Cholinergic synapse
mjv04728  Dopaminergic synapse
mjv04915  Estrogen signaling pathway
mjv04917  Prolactin signaling pathway
mjv04921  Oxytocin signaling pathway
mjv04926  Relaxin signaling pathway
mjv04928  Parathyroid hormone synthesis, secretion and action
mjv04932  Non-alcoholic fatty liver disease
mjv04935  Growth hormone synthesis, secretion and action
mjv05031  Amphetamine addiction
mjv05132  Salmonella infection
mjv05133  Pertussis
mjv05135  Yersinia infection
mjv05140  Leishmaniasis
mjv05142  Chagas disease
mjv05161  Hepatitis B
mjv05162  Measles
mjv05166  Human T-cell leukemia virus 1 infection
mjv05167  Kaposi sarcoma-associated herpesvirus infection
mjv05170  Human immunodeficiency virus 1 infection
mjv05171  Coronavirus disease - COVID-19
mjv05200  Pathways in cancer
mjv05210  Colorectal cancer
mjv05224  Breast cancer
mjv05231  Choline metabolism in cancer
mjv05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mjv05323  Rheumatoid arthritis
mjv05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108402534 (FOS)
   04668 TNF signaling pathway
    108402534 (FOS)
   04024 cAMP signaling pathway
    108402534 (FOS)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108402534 (FOS)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108402534 (FOS)
   04660 T cell receptor signaling pathway
    108402534 (FOS)
   04658 Th1 and Th2 cell differentiation
    108402534 (FOS)
   04659 Th17 cell differentiation
    108402534 (FOS)
   04657 IL-17 signaling pathway
    108402534 (FOS)
   04662 B cell receptor signaling pathway
    108402534 (FOS)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    108402534 (FOS)
   04917 Prolactin signaling pathway
    108402534 (FOS)
   04921 Oxytocin signaling pathway
    108402534 (FOS)
   04926 Relaxin signaling pathway
    108402534 (FOS)
   04935 Growth hormone synthesis, secretion and action
    108402534 (FOS)
   04928 Parathyroid hormone synthesis, secretion and action
    108402534 (FOS)
  09156 Nervous system
   04725 Cholinergic synapse
    108402534 (FOS)
   04728 Dopaminergic synapse
    108402534 (FOS)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108402534 (FOS)
  09159 Environmental adaptation
   04713 Circadian entrainment
    108402534 (FOS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108402534 (FOS)
   05231 Choline metabolism in cancer
    108402534 (FOS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108402534 (FOS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108402534 (FOS)
   05224 Breast cancer
    108402534 (FOS)
  09163 Immune disease
   05323 Rheumatoid arthritis
    108402534 (FOS)
  09165 Substance dependence
   05031 Amphetamine addiction
    108402534 (FOS)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108402534 (FOS)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    108402534 (FOS)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108402534 (FOS)
   05135 Yersinia infection
    108402534 (FOS)
   05133 Pertussis
    108402534 (FOS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108402534 (FOS)
   05170 Human immunodeficiency virus 1 infection
    108402534 (FOS)
   05161 Hepatitis B
    108402534 (FOS)
   05171 Coronavirus disease - COVID-19
    108402534 (FOS)
   05162 Measles
    108402534 (FOS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108402534 (FOS)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    108402534 (FOS)
   05142 Chagas disease
    108402534 (FOS)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    108402534 (FOS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mjv03000]
    108402534 (FOS)
   04131 Membrane trafficking [BR:mjv04131]
    108402534 (FOS)
Transcription factors [BR:mjv03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    108402534 (FOS)
Membrane trafficking [BR:mjv04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    108402534 (FOS)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf Macoilin HALZ
Other DBs
NCBI-GeneID: 108402534
NCBI-ProteinID: XP_017524628
LinkDB
Position
Unknown
AA seq 380 aa
MMFSGFNADYEASSSRCSSASPAGDNLSYYHSPAESFSSMGSPVNAQDFCTDLAVSSASF
IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGVPAPSAGAYARAGVVKTMTGGRT
QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ
TEIASLLKEKEKLEFILAAHRPACKIPNDLGFPEEMSVASLDLSGALPEAATPEAEEAFT
LPLLNDPEPKPSVEPAKSISSMELKAEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYA
ADWEPLHGGSLGMGPMATELEPLCTPVVTCTPSCTTYTSSFVFTYPEADSFPSCAAAHRK
GSSSNEPSSDSLSSPTLLAL
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgatgttctccggcttcaacgccgactacgaggcgtcctcctcccgctgcagcagcgcc
tccccagccggggacaacctctcctactaccactcaccggccgagtccttctccagcatg
ggatctcctgtcaatgctcaggacttctgcacagatctggcagtctccagtgccagcttc
atcccaacggtgacggccatctccaccagtccggacctgcagtggctggtgcagcccaca
ctggtctcctccgtggccccatcccagaccagagctcctcacccctatggagtccctgct
ccctccgctggggcttacgccagggctggagtcgtgaagaccatgacaggagggagaact
cagagcattggcaggaggggcaaggtggaacagttgtccccagaagaagaagaaaaaagg
agaatccgaagggaaaggaataagatggctgcagccaaatgcaggaaccggaggagggag
ctgactgacacgctccaggcggagacagaccaattagaagatgagaagtctgctttgcag
acggagattgccagcttgctgaaggagaaggaaaaactggagttcatcttggcagctcac
cgacctgcctgcaagatccctaatgacctgggcttcccagaggagatgtctgtggcttct
cttgatctgagtggggccctgcccgaggctgccacccccgaggctgaggaggccttcacc
ctaccgctcctcaatgatcctgagcccaagccctcagtggagcctgccaagagcattagc
agcatggagctaaaggccgagccttttgatgacttcctgttcccagcatcgtccaggccc
agcggctctgagaccgcccgctctgtgccagacatggacctgtctggttccttctatgca
gcagactgggagcccctgcatggtgggtccctggggatggggcccatggccacagagctg
gagcccctgtgcaccccagtggtcacctgtactcccagctgcaccacgtacacgtcttct
ttcgtcttcacctaccccgaggctgactccttccccagctgtgcggctgcccaccgcaag
ggcagcagcagcaatgagccctcctctgactcgctcagctcacctacgctgctggccctg
tga

DBGET integrated database retrieval system