KEGG   Manis javanica (Malayan pangolin): 108402880
Entry
108402880         CDS       T06054                                 

Gene name
CISH
Definition
(RefSeq) cytokine-inducible SH2-containing protein isoform X1
  KO
K04701  cytokine inducible SH2-containing protein
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04630  JAK-STAT signaling pathway
mjv04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108402880 (CISH)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    108402880 (CISH)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mjv04121]
    108402880 (CISH)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mjv04990]
    108402880 (CISH)
Ubiquitin system [BR:mjv04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     108402880 (CISH)
Domain-containing proteins not elsewhere classified [BR:mjv04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   108402880 (CISH)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 108402880
NCBI-ProteinID: XP_017525186
LinkDB
Position
Unknown
AA seq 265 aa
MGRDRGCTHCPRPPSRPCPLLALERIGQQPLGVQSLELARPAMQPLAAGAFLEEVTEESP
AQPESEPKVLDPEEDLLCIAKTFSYLRESGWYWGSITASEARQHLQKMPEGTFLVRDSTH
PSYLFTLSVKTTRGPTNVRIEYADSSFRLDSNCLSRPRILAFPDVVSLVQHYVASCAADT
RSDSPDPAPSPALPTPKEGAPGAPALPGPMAAVHLKLVRPFVRRSSGRSLQHLCRLAINR
LVADVDCLPLPRRMADYLRQYPFQL
NT seq 798 nt   +upstreamnt  +downstreamnt
atgggaagggacaggggctgcactcactgcccacgcccaccttctagaccctgtcctttg
ctggctctggagaggattgggcagcagcccctgggggtccagtccctggagctggccaga
ccagctatgcagcctttggctgctggggccttcctggaggaggtgacagaggagagccca
gcccagccagagagtgagcccaaggtgctggaccccgaggaggacctgctgtgcatagcc
aagaccttctcctaccttcgggaatctggctggtattggggttccatcacggccagcgaa
gcccggcaacacctgcagaagatgccagagggcacgttcctggtacgcgacagcacccac
cccagctacctgttcacgctgtcggtcaaaaccacccgtggccccaccaacgtgcgcatc
gagtacgccgactccagcttccgcctggactctaactgcctgtccaggccacgcatcctg
gctttccctgacgtggtcagcctcgtacagcactatgtggcctcctgcgccgctgacacc
cgaagtgacagccctgaccctgctcccagcccagccctgccgacccctaaggaaggtgca
cctggagcaccggcactgcctggccccatggccgctgtgcacctgaagctggtgcggccc
ttcgtgcgcaggagcagtggccgcagcctacagcacctgtgccgactcgccatcaaccgc
ctggtggccgacgtggactgtctgccactgccccggcgcatggctgactacctccggcag
taccccttccagctctga

DBGET integrated database retrieval system