KEGG   Manis javanica (Malayan pangolin): 108402940
Entry
108402940         CDS       T06054                                 

Gene name
BAK1
Definition
(RefSeq) bcl-2 homologous antagonist/killer
  KO
K14021  Bcl-2 homologous antagonist/killer
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01524  Platinum drug resistance
mjv04141  Protein processing in endoplasmic reticulum
mjv04210  Apoptosis
mjv04215  Apoptosis - multiple species
mjv05022  Pathways of neurodegeneration - multiple diseases
mjv05132  Salmonella infection
mjv05160  Hepatitis C
mjv05162  Measles
mjv05163  Human cytomegalovirus infection
mjv05164  Influenza A
mjv05165  Human papillomavirus infection
mjv05167  Kaposi sarcoma-associated herpesvirus infection
mjv05168  Herpes simplex virus 1 infection
mjv05169  Epstein-Barr virus infection
mjv05170  Human immunodeficiency virus 1 infection
mjv05200  Pathways in cancer
mjv05202  Transcriptional misregulation in cancer
mjv05203  Viral carcinogenesis
mjv05206  MicroRNAs in cancer
mjv05210  Colorectal cancer
mjv05212  Pancreatic cancer
mjv05213  Endometrial cancer
mjv05214  Glioma
mjv05216  Thyroid cancer
mjv05217  Basal cell carcinoma
mjv05218  Melanoma
mjv05220  Chronic myeloid leukemia
mjv05222  Small cell lung cancer
mjv05223  Non-small cell lung cancer
mjv05224  Breast cancer
mjv05225  Hepatocellular carcinoma
mjv05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    108402940 (BAK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108402940 (BAK1)
   04215 Apoptosis - multiple species
    108402940 (BAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108402940 (BAK1)
   05202 Transcriptional misregulation in cancer
    108402940 (BAK1)
   05206 MicroRNAs in cancer
    108402940 (BAK1)
   05203 Viral carcinogenesis
    108402940 (BAK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108402940 (BAK1)
   05212 Pancreatic cancer
    108402940 (BAK1)
   05225 Hepatocellular carcinoma
    108402940 (BAK1)
   05226 Gastric cancer
    108402940 (BAK1)
   05214 Glioma
    108402940 (BAK1)
   05216 Thyroid cancer
    108402940 (BAK1)
   05220 Chronic myeloid leukemia
    108402940 (BAK1)
   05217 Basal cell carcinoma
    108402940 (BAK1)
   05218 Melanoma
    108402940 (BAK1)
   05213 Endometrial cancer
    108402940 (BAK1)
   05224 Breast cancer
    108402940 (BAK1)
   05222 Small cell lung cancer
    108402940 (BAK1)
   05223 Non-small cell lung cancer
    108402940 (BAK1)
  09164 Neurodegenerative disease
   05022 Pathways of neurodegeneration - multiple diseases
    108402940 (BAK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108402940 (BAK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108402940 (BAK1)
   05160 Hepatitis C
    108402940 (BAK1)
   05164 Influenza A
    108402940 (BAK1)
   05162 Measles
    108402940 (BAK1)
   05168 Herpes simplex virus 1 infection
    108402940 (BAK1)
   05163 Human cytomegalovirus infection
    108402940 (BAK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108402940 (BAK1)
   05169 Epstein-Barr virus infection
    108402940 (BAK1)
   05165 Human papillomavirus infection
    108402940 (BAK1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108402940 (BAK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mjv03029]
    108402940 (BAK1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mjv02000]
    108402940 (BAK1)
Mitochondrial biogenesis [BR:mjv03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    108402940 (BAK1)
Transporters [BR:mjv02000]
 Other transporters
  Pores ion channels [TC:1]
   108402940 (BAK1)
SSDB
Motif
Pfam: Bcl-2 Bcl-2_3 DUF5700
Other DBs
NCBI-GeneID: 108402940
NCBI-ProteinID: XP_017525282
LinkDB
Position
Unknown
AA seq 211 aa
MASGQGPGPPGQECGETAPSSASEEQVARDTEEVFRSYVFYRHQQEQEAEGAAAPADPEM
ITLPLEPSSTMGQVGRQLAVIGDDINRRYDSEFQAMLQHLQPTAENAYEYFTKIASSLFE
SGINWGRVVALLGFGYRLALHVYQRGLTGFLGQVTRFVADFMLRRCIARWIAQRGGWVAA
LDLGNGPIQNVLIVLAVVLLGQFVVRRFFKS
NT seq 636 nt   +upstreamnt  +downstreamnt
atggcatctgggcaaggcccaggtcctcccgggcaggagtgcggagagactgccccatcc
tctgcgtctgaggagcaggtagcccgggacacggaggaggttttccgcagctacgttttt
taccgccatcagcaggagcaggaggcagagggggcagctgcacccgctgacccagagatg
atcaccttgcctctagaacctagcagcaccatggggcaggtgggtcggcagctcgccgtc
attggggacgacatcaaccggcgctacgactcagagttccaggccatgctgcagcacttg
cagcccacggcagagaatgcctacgagtacttcaccaagatcgcctcaagtctctttgag
agcggcatcaactggggccgagtggtggctctcctgggcttcggctaccgcctagccttg
cacgtctaccagcgtggtctgaccggcttcctggggcaggtgacccgcttcgtggccgac
ttcatgctgcgtcgctgcattgcccgatggattgcgcaaaggggcggctgggtggcagcc
ctggacttgggaaatggccccatccagaatgtgctaatagttctggctgtggttctattg
ggccagtttgtggtacgaagattcttcaagtcatga

DBGET integrated database retrieval system