KEGG   Manis javanica (Malayan pangolin): 108403202
Entry
108403202         CDS       T06054                                 

Definition
(RefSeq) signal transducing adapter molecule 2-like
  KO
K04705  signal transducing adaptor molecule
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04144  Endocytosis
mjv04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108403202
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    108403202
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mjv04131]
    108403202
Membrane trafficking [BR:mjv04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-0 complex
    108403202
SSDB
Motif
Pfam: GAT
Other DBs
NCBI-GeneID: 108403202
NCBI-ProteinID: XP_017525659
LinkDB
Position
Unknown
AA seq 274 aa
SKVNAKDFKVYFVSIAAVDKVNVIDEEEEEIKKSEPEPVYIDEDKMDRALQVLQSIDPTD
SQPDPQDLLDLEVVCQQMGPMIDEKLEEIDRKHSELSELNVKVLEALELYNKLVNEAPIY
SVYSKLHPPAHYSPSSAGVPMQTYPVQSHGGNYMGQSIHQVTVAQSYNLGPDHIGPLRSL
PPNVNSSVTTQPTQTPYLSTGQDPISNPTYMNQNSNLQSATGTAAYAQQMGMSVDMSSYQ
NTTSSLPQLAGFPAAVPAHSVAQQQTNYHQQPLL
NT seq 825 nt   +upstreamnt  +downstreamnt
tccaaagtaaatgctaaggactttaaagtttactttgtttccatagcagctgtggacaaa
gtgaatgtaattgatgaggaggaagaggaaattaagaaatcagagcctgaacctgtttat
atagatgaggataagatggatagagccctgcaagtactccagagtatagatccaacagat
tcacaaccagatccgcaagatctcctggacttagaagttgtctgccaacagatgggtcca
atgatagatgaaaaacttgaagaaattgataggaagcattccgaattgtctgaattaaat
gtaaaagtattggaagctctggaactatataacaaattggtgaatgaagcacccatttat
tcagtctattcaaagctccatcctccagcacattactcaccttcatcagctggggttcca
atgcagacatacccagttcagtcacatggtggaaattatatgggtcaaagtattcaccaa
gtcactgttgcccagagctacaacctaggaccagatcacattggtccactgagatctctg
cctccaaatgtgaattcctcagtgacaacacagcctactcaaactccatacttaagcact
ggacaagaccctatttccaatcctacttatatgaaccagaactctaaccttcaatcagct
accggtacagctgcgtacgcacagcagatggggatgtctgtggatatgtcatcttaccag
aacactacttccagtttgccgcagctggcaggctttccggcagcagttccagctcattca
gttgcacagcagcaaacaaattaccatcagcagcctctcctttag

KEGG   Manis javanica (Malayan pangolin): 108404506
Entry
108404506         CDS       T06054                                 

Definition
(RefSeq) signal transducing adapter molecule 2
  KO
K04705  signal transducing adaptor molecule
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04144  Endocytosis
mjv04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108404506
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    108404506
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mjv04131]
    108404506
Membrane trafficking [BR:mjv04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-0 complex
    108404506
SSDB
Motif
Pfam: VHS SH3_1 SH3_9 SH3_2 UIM ENTH SH3_10
Other DBs
NCBI-GeneID: 108404506
NCBI-ProteinID: XP_017527610
LinkDB
Position
Unknown
AA seq 273 aa
MPLFTANPFEQDVEKATNEYNTAEDWSLIMDICDKVGSTPNGAKDCLKAIMKRVNHKVPH
VALQALTLLGACVANCGKIFHLEVCSRDFATEVRAVIKNKAHPKVCEKLKSLMVEWSEEF
QKDPQFSLISATVKSMKEEGITFPPAGSQTVLAAAKNGTSSNKNKEDEDIAKAIELSLQE
QKQQHTETKSLYPPAEIQLNNKAARKVRALYDFEAVEDNELTFKHGEIIIVLDDSDANWW
KGENHRGIGLFPSNFVTTNLNIESEAGKLNLRE
NT seq 820 nt   +upstreamnt  +downstreamnt
atgcctctattcaccgccaaccccttcgagcaggacgtggaaaaagccacaaatgagtac
aacactgcggaagattggagtcttattatggacatatgtgacaaagttggaagtactcct
aatggagcaaaagattgcctaaaagccataatgaaaagggtaaatcataaggttcctcat
gttgctctgcaggcattaactcttcttggggcttgtgtggcaaactgtggaaagatattt
catttagaagtatgttcccgtgattttgcaacagaagtacgtgctgtgataaaaaataag
gctcatcctaaagtatgtgaaaaactgaaatccttaatggtggagtggtcagaagaattt
caaaaggaccctcagtttagtctaatatctgcaactgtcaagtctatgaaagaagaagga
attacttttccaccagcaggttctcagactgtcttagctgctgccaaaaacggtacgtca
tcgaacaaaaacaaagaagatgaagacatagctaaagctattgaattatcgctgcaagaa
cagaagcaacagcacacggaaaccaagtccttatatccacctgcagagattcagttaaac
aataaagctgcaagaaaagtgagagccttatatgattttgaagccgttgaggacaatgaa
ctcacctttaaacatggtgaaattattattgttttggatgacagtgatgccaattggtgg
aaaggagaaaaccacagaggaataggactcttcccatctaattttgtaacaactaattta
aacatagagtctgaggcaggtaagttaaatcttagggaag

DBGET integrated database retrieval system