KEGG   Manis javanica (Malayan pangolin): 108403236
Entry
108403236         CDS       T06054                                 

Gene name
MCL1
Definition
(RefSeq) induced myeloid leukemia cell differentiation protein Mcl-1
  KO
K02539  myeloid leukemia cell differntiation protein MCL-1
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04151  PI3K-Akt signaling pathway
mjv04210  Apoptosis
mjv04630  JAK-STAT signaling pathway
mjv05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108403236 (MCL1)
   04151 PI3K-Akt signaling pathway
    108403236 (MCL1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108403236 (MCL1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    108403236 (MCL1)
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 108403236
NCBI-ProteinID: XP_017525734
LinkDB
Position
Unknown
AA seq 349 aa
MFGLKRNAVIGLNLYCGGAGLGTGSGGASPSGGRLLTAGKEAAARREAGGEEAGAVIGGS
TGASPPAAIAPDARRVARPSPIGAESPDVTTTPARLLFFAPTRHMSPPEEMEAPAADAIM
SPEEELDGYEPESLGKRPAVLPLLELVGEPSNGSGTDGSLPSTPPAEEEEDELYRQSLEI
ISRYLQEQATGAKDVKPMGVCGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNED
DVKSLSRVMVHVFSDGVTNWGRIVTLISFGAIVAKHLKSINQESCIVPLAESITDVLVRT
KRDWLVKQRGWDGFVEFFRVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgtttggcctcaaaagaaacgcagtaattggactcaacctctactgtgggggggccgga
ttggggaccggcagcggcggcgcctcgccttcgggagggcggcttctgactgcggggaag
gaggccgcagctaggcgggaggcagggggagaggaagccggtgcggtgattggcggaagc
accggcgcgagtcccccggccgcgatcgcgccagatgcccggagggtcgcgcggccctcg
cccattggcgccgagagccccgacgtcactacgacccccgcgaggctgctgttcttcgcg
cccacccgccacatgtcgccgcctgaagaaatggaagccccagctgccgacgccatcatg
tcgcccgaagaggagctggacgggtacgagccggagtctctcgggaagcggccggctgtt
ttgcccttgctggagttggtcggggagcctagtaatggctccggcactgacggctcacta
ccctcgacacccccagcagaggaggaggaggacgaattgtaccggcagtcgctggagatt
atctctcggtatcttcaggagcaggctaccggcgccaaggacgtgaagccaatgggcgtg
tgtggggccgccagccggaaggcgttagagaccctacgaagggtcggggatggtgtgcag
cgcaaccacgagacggccttccaaggcatgcttcgtaaactggacatcaagaacgaagac
gatgtcaaatctttgtctcgagtgatggtccatgttttcagtgacggcgtaacaaactgg
ggcaggattgtgactctcatttcttttggtgccattgtggccaaacacttgaaaagtata
aaccaagaaagctgcatcgtaccattagcagaaagcatcacagatgttctcgtaaggaca
aaacgagactggctagtcaaacaaagaggctgggatggttttgtggaattcttccgtgta
gaggacctagaaggtggcatcagaaatgtgctgttggcatttgcaggtgttgctggagta
ggagctggtttggcatatctaataagatag

DBGET integrated database retrieval system