KEGG   Manis javanica (Malayan pangolin): 108403291
Entry
108403291         CDS       T06054                                 

Gene name
IL17D
Definition
(RefSeq) LOW QUALITY PROTEIN: interleukin-17D
  KO
K05492  interleukin 17D
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04625  C-type lectin receptor signaling pathway
mjv04630  JAK-STAT signaling pathway
mjv04657  IL-17 signaling pathway
mjv04659  Th17 cell differentiation
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108403291 (IL17D)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108403291 (IL17D)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    108403291 (IL17D)
   04659 Th17 cell differentiation
    108403291 (IL17D)
   04657 IL-17 signaling pathway
    108403291 (IL17D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mjv04052]
    108403291 (IL17D)
Cytokines and growth factors [BR:mjv04052]
 Cytokines
  Interleukins
   108403291 (IL17D)
SSDB
Motif
Pfam: IL17
Other DBs
NCBI-GeneID: 108403291
NCBI-ProteinID: XP_017525820
LinkDB
Position
Unknown
AA seq 142 aa
MESDIVTDRVMPRGRPADRRFRPPTNLRSVSPWAYRISYDPARYPKYLPEAYCLCRGCLT
GLFGEEDFHFRSTPVYMPTAILRRTSACAGGRSVYTEEYVTIPVGAPASPSRRXCTCVPE
PEKEANSVNSSMDKRGAKPGRP
NT seq 429 nt   +upstreamnt  +downstreamnt
atggagtccgacattgtaacagaccgagtgatgcccaggggcaggccagccgaccggcgc
ttccggccgcccaccaacctgcgcagcgtgtcgccctgggcctacagaatttcctacgac
cctgccaggtaccccaagtacctgcctgaggcctactgcctgtgcaggggctgcctgacc
gggctgttcggggaggaggattttcacttccgcagcaccccggtgtacatgcccaccgcc
atcctccggaggacctccgcctgcgccgggggccgctccgtgtacacagaggagtacgtc
accatccccgtgggcgcacctgcgtccccgagccggagaanctgcacctgcgtccccgag
ccggagaaggaagccaacagtgtcaactccagcatggacaagcggggtgccaagcccggc
cggccctga

DBGET integrated database retrieval system