KEGG   Manis javanica (Malayan pangolin): 108403678
Entry
108403678         CDS       T06054                                 

Gene name
GFAP
Definition
(RefSeq) glial fibrillary acidic protein isoform X1
  KO
K05640  glial fibrillary acidic protein
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108403678 (GFAP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mjv04131]
    108403678 (GFAP)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mjv04812]
    108403678 (GFAP)
Membrane trafficking [BR:mjv04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Other CMA associated proteins
    108403678 (GFAP)
Cytoskeleton proteins [BR:mjv04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Type III
     108403678 (GFAP)
SSDB
Motif
Pfam: Filament Filament_head Spc7 DUF1664 GAS
Other DBs
NCBI-GeneID: 108403678
NCBI-ProteinID: XP_017526462
LinkDB
Position
Unknown
AA seq 471 aa
MERRRVTSAARRSYVSSLEMVGGLGPGRRLGPGTRLSLARMPPSFPARVDFSLAGALNTG
FKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRSKEPTKLADVYQAELR
ELRLQLDQLTANSARLEVERDNLAQDLGTLRQKLQDETNLRLEAENNLAAYRQEADEATL
ARLDLERKTESLEEEIRFLRKVHEEEVRELQEQLARQQVHVELDVAKPDLTAALREIRTQ
YEAVASSNMQEAEEWYRSKFADLTDAAARNAEMLRQAKHEANDYRRQLQSLTCDLESLRG
TNESLERQMREQEERHAREAASYQEALARLEEEGQSLKDEMARHLQEYQDLLNVKLALDI
EIATYRKLLEGEENRITIPVQTFSNLQIRGGKSTKEGESHKVTRHLKSLTIQVIPIQTHQ
IVNGAPPALETSLDTKSVSEGHLKRNIVVKTVEMRDGEVIKESKQEHKDVM
NT seq 1416 nt   +upstreamnt  +downstreamnt
atggagaggagacgcgtcacttcagctgctcgccgctcctacgtctcctctttggagatg
gtggggggcttgggtcctggccgccgcctgggtcctggcacacgtctctccctggctcga
atgcctccttcatttccagcccgggtggacttctccctggctggggcactcaacactggc
ttcaaggagacacgagccagtgagcgggctgagatgatggagctcaatgaccgctttgcc
agctacattgagaaggtgcgctttctggaacagcagaacaaggcgctggctgctgagctg
aaccagctgcggtccaaggagcccaccaaactggctgacgtctaccaggctgagctacgt
gagctacgactgcagctcgatcaactcacagccaacagtgcccggcttgaggtcgagagg
gacaatctggcacaggacctgggcaccctgaggcagaagctccaggatgaaaccaacctg
aggctggaggctgagaacaacctggcagcctatcgacaggaggcagatgaagccaccctg
gcccgtctggatctagaacggaagactgagtctctggaagaagaaatccggttcttgagg
aaggtccatgaggaggaggtgcgggagctccaggagcagctggcccggcagcaggtccat
gtggagctggatgtagccaagccagacctcacagcagccctgagagagatccgcacacag
tacgaggcagtggcatccagcaacatgcaggaggcggaggagtggtaccggtctaagttt
gcggacctgacagacgccgctgcccgcaacgcggagatgctccgccaggccaagcacgag
gccaacgactaccggcgccagctgcagtccctgacctgtgacctggagtccttgcgcggc
acgaacgagtccctggagaggcagatgcgggagcaggaggagcgccacgcgcgcgaggcg
gccagttaccaggaggcgctggcccgactggaggaggaggggcagagcctcaaggacgag
atggcccgccacctgcaggagtaccaagacctgctcaacgtcaagctggccctggacatc
gagatcgccacctaccgaaagctgctggagggcgaggagaaccgcatcaccattcctgtg
cagaccttctccaacctgcagatccgagggggcaaaagcaccaaagaaggggaaagtcac
aaggtcacaagacatctcaaaagcctcacaatacaagttataccaatacagactcaccag
attgtaaatggagccccgccggctctcgaaaccagcctggacaccaagtctgtgtcagaa
ggccacctcaagaggaacattgtggtgaagactgtggagatgagggatggagaggtcatt
aaggaatccaagcaggagcataaggatgtgatgtga

DBGET integrated database retrieval system