KEGG   Manis javanica (Malayan pangolin): 108404266
Entry
108404266         CDS       T06054                                 

Gene name
TP53
Definition
(RefSeq) cellular tumor antigen p53
  KO
K04451  tumor protein p53
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01522  Endocrine resistance
mjv01524  Platinum drug resistance
mjv04010  MAPK signaling pathway
mjv04071  Sphingolipid signaling pathway
mjv04110  Cell cycle
mjv04115  p53 signaling pathway
mjv04137  Mitophagy - animal
mjv04151  PI3K-Akt signaling pathway
mjv04210  Apoptosis
mjv04211  Longevity regulating pathway
mjv04216  Ferroptosis
mjv04218  Cellular senescence
mjv04310  Wnt signaling pathway
mjv04722  Neurotrophin signaling pathway
mjv04919  Thyroid hormone signaling pathway
mjv05012  Parkinson disease
mjv05014  Amyotrophic lateral sclerosis
mjv05016  Huntington disease
mjv05160  Hepatitis C
mjv05161  Hepatitis B
mjv05162  Measles
mjv05163  Human cytomegalovirus infection
mjv05165  Human papillomavirus infection
mjv05166  Human T-cell leukemia virus 1 infection
mjv05167  Kaposi sarcoma-associated herpesvirus infection
mjv05168  Herpes simplex virus 1 infection
mjv05169  Epstein-Barr virus infection
mjv05200  Pathways in cancer
mjv05202  Transcriptional misregulation in cancer
mjv05203  Viral carcinogenesis
mjv05205  Proteoglycans in cancer
mjv05206  MicroRNAs in cancer
mjv05210  Colorectal cancer
mjv05212  Pancreatic cancer
mjv05213  Endometrial cancer
mjv05214  Glioma
mjv05215  Prostate cancer
mjv05216  Thyroid cancer
mjv05217  Basal cell carcinoma
mjv05218  Melanoma
mjv05219  Bladder cancer
mjv05220  Chronic myeloid leukemia
mjv05222  Small cell lung cancer
mjv05223  Non-small cell lung cancer
mjv05224  Breast cancer
mjv05225  Hepatocellular carcinoma
mjv05226  Gastric cancer
mjv05230  Central carbon metabolism in cancer
mjv05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108404266 (TP53)
   04310 Wnt signaling pathway
    108404266 (TP53)
   04071 Sphingolipid signaling pathway
    108404266 (TP53)
   04151 PI3K-Akt signaling pathway
    108404266 (TP53)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    108404266 (TP53)
  09143 Cell growth and death
   04110 Cell cycle
    108404266 (TP53)
   04210 Apoptosis
    108404266 (TP53)
   04216 Ferroptosis
    108404266 (TP53)
   04115 p53 signaling pathway
    108404266 (TP53)
   04218 Cellular senescence
    108404266 (TP53)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    108404266 (TP53)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    108404266 (TP53)
  09149 Aging
   04211 Longevity regulating pathway
    108404266 (TP53)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108404266 (TP53)
   05202 Transcriptional misregulation in cancer
    108404266 (TP53)
   05206 MicroRNAs in cancer
    108404266 (TP53)
   05205 Proteoglycans in cancer
    108404266 (TP53)
   05203 Viral carcinogenesis
    108404266 (TP53)
   05230 Central carbon metabolism in cancer
    108404266 (TP53)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108404266 (TP53)
   05212 Pancreatic cancer
    108404266 (TP53)
   05225 Hepatocellular carcinoma
    108404266 (TP53)
   05226 Gastric cancer
    108404266 (TP53)
   05214 Glioma
    108404266 (TP53)
   05216 Thyroid cancer
    108404266 (TP53)
   05220 Chronic myeloid leukemia
    108404266 (TP53)
   05217 Basal cell carcinoma
    108404266 (TP53)
   05218 Melanoma
    108404266 (TP53)
   05219 Bladder cancer
    108404266 (TP53)
   05215 Prostate cancer
    108404266 (TP53)
   05213 Endometrial cancer
    108404266 (TP53)
   05224 Breast cancer
    108404266 (TP53)
   05222 Small cell lung cancer
    108404266 (TP53)
   05223 Non-small cell lung cancer
    108404266 (TP53)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    108404266 (TP53)
   05014 Amyotrophic lateral sclerosis
    108404266 (TP53)
   05016 Huntington disease
    108404266 (TP53)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108404266 (TP53)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108404266 (TP53)
   05161 Hepatitis B
    108404266 (TP53)
   05160 Hepatitis C
    108404266 (TP53)
   05162 Measles
    108404266 (TP53)
   05168 Herpes simplex virus 1 infection
    108404266 (TP53)
   05163 Human cytomegalovirus infection
    108404266 (TP53)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108404266 (TP53)
   05169 Epstein-Barr virus infection
    108404266 (TP53)
   05165 Human papillomavirus infection
    108404266 (TP53)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108404266 (TP53)
   01522 Endocrine resistance
    108404266 (TP53)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mjv03000]
    108404266 (TP53)
   03036 Chromosome and associated proteins [BR:mjv03036]
    108404266 (TP53)
   03400 DNA repair and recombination proteins [BR:mjv03400]
    108404266 (TP53)
Transcription factors [BR:mjv03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    108404266 (TP53)
Chromosome and associated proteins [BR:mjv03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     108404266 (TP53)
DNA repair and recombination proteins [BR:mjv03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    108404266 (TP53)
SSDB
Motif
Pfam: P53 P53_tetramer P53_TAD
Other DBs
NCBI-GeneID: 108404266
NCBI-ProteinID: XP_017527253
LinkDB
Position
Unknown
AA seq 384 aa
MEHQQSELNIEPPLSQETFSDLWKLLPENNVLSSELSPLSPEVDKLLLSTEDIVNWLGEG
PDEAPAPAAPAPAAPASATSWPLSSFVPSQKTYPGRYGFHLGFLHSGTAKSVTCTYSPSL
NKLFCQLAKTCPVQLWVSSPPPPGTRVRAMAIYKKSEYMTEVVRRCPHHERCSDYSDGLA
PPQHLIRVEGNLRAEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNFMCNSSCMGGMNRR
PILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENSRKKGEPRPEPPPGSTKRALP
SNSSSSPSQKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQTGKEAGGSRAHSSHL
KSKKGQSTSRHKKLMFKREGPDSD
NT seq 1155 nt   +upstreamnt  +downstreamnt
atggagcatcagcagtcagaactcaacattgagccccctctgagccaggagaccttttca
gacttgtggaaactacttcccgaaaacaatgtgctgtcctctgagctgtccccactgtcc
ccagaggtggacaaactgctgctgtccacagaagacattgtgaactggttaggagaaggt
ccagatgaagctcctgcaccagcagctcctgcaccagcagccccggcatcagccacttca
tggcccctgtcatcctttgtcccttcccagaagacctaccctggcagatatggtttccat
ttagggttcctgcattccgggacagccaagtctgttacctgcacgtactccccttccctc
aacaaactgttttgccagctggcaaagacctgcccagtgcagctgtgggtcagctcgcca
cccccgcccggcacccgtgtccgcgccatggccatctacaaaaagtcagagtacatgaca
gaggtggtgaggcgctgcccccaccatgaacgctgctctgactacagtgatggtctggcc
ccccctcagcatctcatccgggtggaaggaaatttgcgtgctgagtatttggatgacagg
aacacttttcgacatagtgtggtggtgccttatgagccacctgaggtcggctctgactgt
accaccatccactacaacttcatgtgtaacagttcctgcatgggtggcatgaaccggcgg
cccatcctcaccatcatcacactggaggactccagtggcaatctgctgggacggaacagc
tttgaggtgcgtgtttgtgcctgtcctgggagagatcggcgcacagaggaagaaaactcc
cgcaagaaaggggagccccgccccgagccaccccctgggagcaccaagcgagcactgccc
agcaactccagttcctctccctcacaaaagaagaagccactggacggagaatattttacc
cttcagatccgtgggcgtgaacgctttgagatgttcagagagctgaatgaagccttggag
ctgaaggatgcccagactggaaaagaggccgggggtagcagggcccactccagccacctg
aagtctaagaaggggcagtctacctcccgccataaaaaactgatgttcaagagagaaggg
cctgactcagactga

DBGET integrated database retrieval system