KEGG   Manis javanica (Malayan pangolin): 108405149
Entry
108405149         CDS       T06054                                 

Gene name
IL4R
Definition
(RefSeq) interleukin-4 receptor subunit alpha isoform X1
  KO
K05071  interleukin 4 receptor
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04151  PI3K-Akt signaling pathway
mjv04630  JAK-STAT signaling pathway
mjv04640  Hematopoietic cell lineage
mjv04658  Th1 and Th2 cell differentiation
mjv04659  Th17 cell differentiation
mjv05200  Pathways in cancer
mjv05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108405149 (IL4R)
   04151 PI3K-Akt signaling pathway
    108405149 (IL4R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108405149 (IL4R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108405149 (IL4R)
   04658 Th1 and Th2 cell differentiation
    108405149 (IL4R)
   04659 Th17 cell differentiation
    108405149 (IL4R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108405149 (IL4R)
  09163 Immune disease
   05321 Inflammatory bowel disease
    108405149 (IL4R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mjv04050]
    108405149 (IL4R)
   04090 CD molecules [BR:mjv04090]
    108405149 (IL4R)
Cytokine receptors [BR:mjv04050]
 Interleukin receptor families
  IL2 receptor family
   108405149 (IL4R)
CD molecules [BR:mjv04090]
 Proteins
  108405149 (IL4R)
SSDB
Motif
Pfam: IL4Ra_N fn3
Other DBs
NCBI-GeneID: 108405149
NCBI-ProteinID: XP_017528636
LinkDB
Position
Unknown
AA seq 891 aa
MCLSSQDWLYPVCPFQYPPQANSVAKGGKRSRKPVGLRRSPPRPLPDCCWLLTLQDSQLT
SPQMKRQVPQDLPMGWLRSRLMFPVSWLILVWVAGSGSVKVLNAPTCFSDYIFTSTCEWK
MDGPTNCSNNLRLSYQLNFEGFENHTCVPENRESTVCVCTMLIAEPVIADVYQLDLWAGR
QQLWSDSFKPSSHVKPRAPGNLTIHPTSQTWVLTWSNPYPDENYLHRELTYLVNVSNEHD
PADFRIYNVTYMEPTLRLVASTLKSGASYSARVRAWAQIYNSTWSEWSPSTNWTNYYKPW
EQRLSLGISIACVIILAVCPVCYISIIKIKKEWWDQIPNPAHSALVAIVIQDSQVPLWGK
QSRGQEPAKCLHWKTCLTKLLPCLLEHGMEKDEDSSKAAKNGPFQGPGKPAWHPVEVSKM
VLWPEDISVVRCVEIFEAQVGNEEEEVEEDKESFCPSPENSGSSFQEGREGIAARLTEHL
FLDILEGENGGFCPQGLGELCLPPPSGSTQMPWAEFPSEEPQEAPSLGKEQTFNPESNPL
ATLTQSPASLAFTETPSVVTDNPAYRRFSDFLSQSSGSGELNSDPQLAECLEEADSSVLS
AVQPSEPPTAPQPQLETWEQILRQSVLQHRAAPAPASAPTSAYRELVHMVGPRRLQDSGV
AGFGSSGEAGYKAFSSVITNSAICPGTSRIEASNGEGGYRPFQSLTPGCPAASAPVPGPL
FTFGLDMEPPHSPQNSFFPSSNPEHFGLEPVVKGEDSQKALLCPEPATEPLRDDLGSGIV
YSALTCHLCGHLKQCHGQEEHGKAILASRCCGCCCGDRSSPSVSPLRALDPLPGGVPLGA
SLPPAPLEPLGTSEEGKSPLFFPPDPSNTPSLSHTPKMVMLSTGPTGTSTS
NT seq 2676 nt   +upstreamnt  +downstreamnt
atgtgcctttcatcacaggactggctgtatcctgtctgcccattccagtaccccccgcaa
gccaattcagtggctaagggagggaaaaggagcaggaagcctgttgggctcaggaggagc
cctcctcggccgcttcccgactgctgctggcttctgacacttcaggactcgcaactcacc
tccccccagatgaaaagacaggtgcctcaggatctcccaatggggtggcttcgctctagg
ctcatgttccctgtgagctggctgatcctggtgtgggtggcaggctctgggagtgttaag
gtcctgaatgcgcccacttgcttctcagactacatcttcacctccacctgtgagtggaag
atggatggtcccaccaactgcagcaacaacctccgcctgtcctaccagctgaattttgaa
gggtttgaaaaccacacgtgtgtccctgagaacagagaaagcacggtttgcgtgtgcact
atgctgattgctgagccggtcatagcggacgtctatcagctagacctgtgggctgggagg
cagcagctgtggagcgacagcttcaagcccagctcccatgtgaaacccagggccccggga
aacctcacgatccaccccacctcccagacctgggtgctgacgtggagcaacccgtaccct
gatgagaattacctgcatcgggagctcacctacctggtcaacgtttcaaatgaacatgac
cctgcggatttcagaatctataatgtgacctacatggagcccaccctccgcttggtggcc
agcaccctaaagtctggggcttcctacagtgcacgagtaagggcctgggcccagatctac
aatagcacttggagtgagtggagccccagcaccaactggactaactactacaagccctgg
gagcagcgcctctcacttggcatcagcattgcctgcgtcatcatcctggctgtctgccca
gtctgctatatcagcattatcaagattaagaaggaatggtgggaccagatccctaaccca
gcccacagtgcactcgtggccattgtcatccaggactcccaggtgccactgtggggaaaa
cagtcccgaggccaggaaccagccaagtgcctacactggaagacttgtcttaccaagctc
ctgccctgtttactggagcatggaatggaaaaggacgaggattcctccaaggctgccaaa
aatgggccttttcagggtcctggaaaacctgcatggcaccctgtagaggtcagcaagatg
gtcctctggccggaagacatcagtgtggtgcggtgcgtggagatctttgaggcccaggta
gggaatgaagaggaggaggtggaagaagataaagagagcttctgcccatcgcctgagaac
agtgggagcagcttccaggagggcagggaaggcatcgcggcccggctaacggagcacctg
ttcctggacattcttgagggtgagaatgggggcttctgcccacagggcttgggggagttg
tgccttcccccaccgtcaggaagtacccagatgccctgggctgagttcccaagtgaggag
ccccaggaggcaccgtccctgggcaaggagcagacttttaacccggagtcaaatccactg
gctactctgacacaaagcccagccagcctggctttcacagagacgccttctgtagtcaca
gacaatcccgcttaccgccgcttcagcgactttctgagccagtcgtcaggttctggagag
ctcaactcagacccacagctggccgagtgcctggaggaagcggactccagtgtcctctct
gccgtgcagccctctgagccacccacagcaccccagccacagctggaaacctgggagcag
attctccgccagagtgtgctccagcacagggcagccccagcccccgcttcagcccccacg
agtgcctaccgggagcttgtgcacatggtggggccgcgcagactgcaggacagtggggtg
gcgggctttggctcttcgggagaagctgggtacaaggccttctccagtgtgatcactaac
agtgccatctgcccagggacatctcggattgaggccagtaatggggaagggggctacagg
cccttccagagcctcactcctggctgtcctgcagcttctgccccagtccctggccctctg
ttcacctttggactggacatggagccacctcacagccctcagaactcattcttcccaagc
agcaacccagagcactttggcctggagccagtggtaaagggtgaggatagccagaaggcc
ctgctctgcccagagccagccacagagcccctcagggatgacctggggagcggcattgtg
tactcagcccttacctgccacctctgtggccacctgaagcagtgtcatgggcaggaagag
catggcaaggccatcctagccagccgctgctgtggctgctgctgtggagacaggtcctca
ccctcagtgagccccttgagggccctagaccctctgccaggtggggttccactgggggcc
agcctccctccagcccccttggaacccctgggcacgtcagaggagggtaaatcacccctg
ttcttcccgcctgaccccagcaatactccaagtttaagccacactcccaaaatggtaatg
ctctccacagggcccacaggcacgagcacttcctaa

DBGET integrated database retrieval system