KEGG   Manis javanica (Malayan pangolin): 108405166
Entry
108405166         CDS       T06054                                 

Gene name
EEF2K
Definition
(RefSeq) eukaryotic elongation factor 2 kinase
  KO
K08292  elongation factor 2 kinase [EC:2.7.11.20]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04152  AMPK signaling pathway
mjv04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    108405166 (EEF2K)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    108405166 (EEF2K)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mjv01001]
    108405166 (EEF2K)
Enzymes [BR:mjv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.20  elongation factor 2 kinase
     108405166 (EEF2K)
Protein kinases [BR:mjv01001]
 Serine/threonine kinases: Other
  Alpha family [OT]
   108405166 (EEF2K)
SSDB
Motif
Pfam: Alpha_kinase
Other DBs
NCBI-GeneID: 108405166
NCBI-ProteinID: XP_017528656
LinkDB
Position
Unknown
AA seq 724 aa
MADEDLIFRLEGIDGSQTPRAGHDRESDADSDEEDGYFICSITDDPRSHQSVNSKVDNYY
SDLRKGEQYGSSGSPASSFHFKEAWKHAIEKAKHMPDPWAEFHLEDVATECATRHRYNAV
TGEWLEDEVLIKVASQPFGRGAMRECFRTKKLSNFLHTQQWKGASNYVAKRYIESVDRDV
YFEDVRLQMEAKLWGEEYNRHKPPKQVDIMQMCVVELKERPGQPLFHLEHYIEGKYIKYN
SNSGFVRDDNMRLTPQAFSHFTFERSGHQLIVVDIQGVGDLYTDPQIHTEKGTDFGDGNL
GVRGMALFFYSHACNRICKSMGLAPFDLSPRERDAVNQNTKLLQSAKTILRGTEEKCGSP
RVRTFSGSRPPLLLRLSENSGDENMSDVTSDSLPSSPSSATPHSQKLDQLHWPVFSDDNM
TPRDHDHLDNHRDSENSGDSGYPSEKRGELDDPELREHGHSNGSRRYESDEDSLGSSGRV
CVEKWNLFNSARLHLPRPSAVALEVQRLNALDLEKKIGKSILGKVHLAIVRYHEGGRFCK
KDEEWDCESAVFHLEHAADLGELEAIVGLGLMYSQLPHHILADVSLQDTEENKTKGFDYL
LKAAEAGDRQSMILVARAFDTGQNLSPDRSRNWPEALHWYNTALETTDCDEGGEYDGMQD
EPRYTLLAREADMLFTGGCGLEKDPQRSGDLYTQAAEAAMEAMKGRLANQYYQQAEEAWA
QMEE
NT seq 2175 nt   +upstreamnt  +downstreamnt
atggcggacgaagacctcatcttccgcctggaaggcattgacggcagccagaccccccgg
gctggccacgaccgggaatctgacgcagacagcgacgaggaggatggttacttcatctgt
tccatcaccgatgaccccaggtcacaccagagcgtcaattccaaggttgataactactac
agcgaccttaggaagggtgaacagtacggctccagcgggtctccagccagttccttccat
tttaaggaagcctggaagcatgcgattgagaaggccaagcacatgcccgacccctgggct
gagttccacctagaggacgttgccacagaatgtgccacccgtcacaggtacaatgctgtc
actggagagtggctggaagatgaagttctgatcaaggtggcatctcagcccttcggccgt
ggagccatgagggagtgcttccgcacgaagaagctctccaacttcctacacacccagcag
tggaagggggcctccaactatgtggcaaagcgctacattgagtctgtggacagggatgtg
tactttgaagacgtgcgtctgcaaatggaggccaagctctggggagaggagtataatcgg
cacaagccccccaagcaggtggacatcatgcagatgtgcgtcgtggagctgaaggagagg
cctggccagcccctcttccacctggagcactatattgagggcaagtacatcaagtacaac
tccaactcaggttttgtccgtgatgacaacatgcgcctgacaccacaggccttcagccac
ttcacatttgagcgttccggccatcagctgattgtggtggacatccagggtgtgggcgac
ctctacaccgacccacagatccacactgagaagggcacggactttggagatggcaacctg
ggtgtccgggggatggctctcttcttctattctcatgcctgcaaccggatttgcaagagc
atgggcctcgctcccttcgacctctcgccaagagaaagggatgcagtgaatcagaacacc
aagctgctgcaatcagccaagaccatcttgagggggacagaggaaaagtgtgggagcccc
cgagtaaggaccttttctgggagccggccccccctgctcctacgcctttcagagaactct
ggagacgagaacatgagcgacgtgacctctgactctctcccctcctccccatcttcggcc
acaccacacagccagaaactggaccaactccactggcccgtgttcagcgacgataacatg
acaccccgagaccatgaccatctggacaaccatcgggactctgagaacagtggggacagc
ggataccccagtgagaagaggggtgagctggatgatccagagctccgagaacacggccac
tcaaacggcagccggaggtacgagtcggacgaggacagcctgggcagctctggacgggtc
tgcgtggagaaatggaatctcttcaactcagcacgcctccacctgcccaggccttctgcc
gtggccttggaagtgcaaaggcttaatgctctggaccttgaaaagaaaatcgggaagtcc
attttggggaaggtccatctggccatagtgcgctaccacgagggcgggcgcttctgcaag
aaggatgaggagtgggactgcgagtcagccgtcttccatctggagcacgcggccgacctg
ggcgagctggaggccatcgtgggcctgggactcatgtactcacagctgccccaccacatc
ctggccgatgtctctctgcaggacacagaagagaataagaccaaagggtttgattactta
ctgaaggcagctgaagctggtgacagacagtccatgatcctggtggcccgagcttttgac
actggccagaacctcagcccagacaggtcccgaaactggccagaggctctgcactggtac
aacactgccctggagacaacagactgtgatgagggcggtgagtatgacgggatgcaggat
gagccccggtacacgctgctggccagggaggccgacatgctgttcacaggcggctgcggg
ctggagaaggacccgcagagatcaggcgacctgtacacccaggcggctgaggcagcgatg
gaagctatgaagggccgactggccaaccagtactaccagcaggcggaggaggcctgggcc
cagatggaggagtga

DBGET integrated database retrieval system